BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30012 (485 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40065| Best HMM Match : ABC_tran (HMM E-Value=0.0055) 30 0.88 SB_22062| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_55578| Best HMM Match : 7tm_1 (HMM E-Value=0) 29 2.0 SB_49708| Best HMM Match : Homeobox (HMM E-Value=8.1e-30) 29 2.0 SB_6588| Best HMM Match : 7tm_1 (HMM E-Value=0) 29 2.0 SB_51696| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_15827| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 >SB_40065| Best HMM Match : ABC_tran (HMM E-Value=0.0055) Length = 400 Score = 30.3 bits (65), Expect = 0.88 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +3 Query: 258 SFSNSETTEVSLF*SNECMMATH--AAACTQAFEILSHRFQNTYTYECYQTQRIILV 422 +F ++ + + F SN C+ A + AC QAF +S+ T T+ Y T +L+ Sbjct: 338 TFESNTSLQAVTFVSNACLQAVTFVSNACLQAFIFVSNACLQTITFVSYATTGNLLI 394 >SB_22062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 30.3 bits (65), Expect = 0.88 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Frame = -3 Query: 381 MCFEIGEIEFQTLVYTQRRGLPSYIHLIKIKIPQWFLNWKTIHKSEIY---AFI*HNPLT 211 +C E + +V T+R+ L SY+ L + ++ WF N +T K + + NPL+ Sbjct: 145 LCLETSFDKNHYVVGTERKQLASYLKLSETQVKVWFQNRRTKWKRQALEGNTNMHKNPLS 204 Query: 210 PLFR 199 P + Sbjct: 205 PYLK 208 >SB_55578| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 333 Score = 29.1 bits (62), Expect = 2.0 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = -1 Query: 194 LLFDTMFGHFVILSSTYTFNEIQIFV*Y 111 L+F T+FG+ +++S YTF +++ Y Sbjct: 34 LMFFTLFGNIIVISCFYTFQDLRTICNY 61 >SB_49708| Best HMM Match : Homeobox (HMM E-Value=8.1e-30) Length = 197 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -3 Query: 345 LVYTQRRGLPSYIHLIKIKIPQWFLNWKTIHKSE 244 +V T+R+ L SY++L + +I WF N +T K + Sbjct: 116 IVGTERKQLASYLNLSETQIKVWFQNRRTKWKRQ 149 >SB_6588| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 355 Score = 29.1 bits (62), Expect = 2.0 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = -1 Query: 194 LLFDTMFGHFVILSSTYTFNEIQIFV*Y 111 L+ T+FG+F++ +S YTF++++ Y Sbjct: 29 LMLATLFGNFLVFASFYTFHDLRTICNY 56 >SB_51696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -3 Query: 336 TQRRGLPSYIHLIKIKIPQWFLNWKTIHKSEIYA 235 ++R GL S +HL + ++ WF N + K +I A Sbjct: 241 SERAGLASQLHLTETQVKIWFQNRRNKWKRQIAA 274 >SB_15827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 365 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 220 IVLYKSIYFGFVNRFPIQKPLRYLYFNQMN 309 ++L S FGF++R P Q L +LYF ++ Sbjct: 178 MILISSNMFGFLDRLPRQIHLVWLYFGTLS 207 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,951,289 Number of Sequences: 59808 Number of extensions: 248427 Number of successful extensions: 396 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 391 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1026164244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -