BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_C22 (890 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 130 2e-30 SB_12542| Best HMM Match : Collagen (HMM E-Value=1.3) 29 3.8 SB_42286| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_14427| Best HMM Match : Cadherin (HMM E-Value=0) 29 5.1 SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15) 28 8.8 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 130 bits (313), Expect = 2e-30 Identities = 64/89 (71%), Positives = 72/89 (80%) Frame = +2 Query: 140 ARPLXVGVFREERDGAGXQPSPSRFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQ 319 ARP+ + VF E + AG P+ VFKAPIRPDLVN VH +++KN RQPY V+K AGHQ Sbjct: 2 ARPV-ITVFNENGESAGQTTLPA--VFKAPIRPDLVNFVHSNIAKNKRQPYAVNKLAGHQ 58 Query: 320 TSAESWGTGRAVARIPRVRGGGTHRSGQG 406 TSAESWGTGRAVARIPRVRGGGTHRSGQG Sbjct: 59 TSAESWGTGRAVARIPRVRGGGTHRSGQG 87 Score = 122 bits (295), Expect = 3e-28 Identities = 60/137 (43%), Positives = 76/137 (55%) Frame = +3 Query: 408 AFGNMCRGGRMFAPTKPWRRWHXXXXXXXXXXXXXXXXXXXXXXXXXQARGHIIEKIPEL 587 AFGNMCRGGRMFAPTK WR+WH ARGH IEKI E+ Sbjct: 88 AFGNMCRGGRMFAPTKTWRKWHTKVNVQQRRFAVCSALAASALPALIMARGHRIEKIAEV 147 Query: 588 PLVVADKVQEINKTKQAVIFLRRLKAWSDILKGVQVSASSCW*G*NAQPSSYQRKGPLII 767 PLV++D ++ + KT AV L+ + A+ D+ K + G + RKGPLII Sbjct: 148 PLVISDAIESVTKTSAAVKLLKAVNAYEDVEKCIDSKKIRAGKGKMRNRRTVMRKGPLII 207 Query: 768 FNKDQGLTRAFRXIPGV 818 +N DQGL +AFR +PGV Sbjct: 208 YNNDQGLRQAFRNLPGV 224 >SB_12542| Best HMM Match : Collagen (HMM E-Value=1.3) Length = 532 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 268 VQELEAALLREQGGWSPNQCRIMGYRTCCRPNSSCPWWW 384 + E A L+ G P++ I+ +R CCR N C W+W Sbjct: 221 ITEAAAVLIVVNGTGVPDRL-IVSFRGCCRVN--CNWYW 256 >SB_42286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1820 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 512 CQGRSPLSEVDATVPAPPGLRGGEHTSTTT 423 C GR+P++ + TV P GL+ GE + T Sbjct: 832 CTGRNPINVSEKTVTLPFGLKAGEVVAKVT 861 >SB_14427| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2325 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +2 Query: 239 DLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAVARI 364 D+ NDV ++++ + PY + H T E TG+ +A++ Sbjct: 2034 DVTNDVTINVTDVNEAPYDIRLVPSHVTVKEDIRTGQCIAQV 2075 >SB_49585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -2 Query: 721 YPYQHEDAETCTPLR-ISDHALRRL 650 +P+ HED C P R SDH +RL Sbjct: 425 FPWAHEDLPICLPSRGASDHVWKRL 449 >SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15) Length = 715 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +2 Query: 233 RPDLVNDVHVSMSKNSRQPYC-VSKEAGHQTSAESWGTGRAV 355 RP +SM K R+PY + +E GH+ S T R V Sbjct: 156 RPGCDTHEKISMEKRKREPYLELIRETGHERQRRSVSTERNV 197 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,550,618 Number of Sequences: 59808 Number of extensions: 568169 Number of successful extensions: 1496 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1492 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2550281014 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -