SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0113
         (659 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   3e-04
SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   6e-04
SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.013
SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.051
SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.089
SB_595| Best HMM Match : CH (HMM E-Value=0)                            32   0.36 
SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22)                 32   0.48 
SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.48 
SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082)                 32   0.48 
SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0)                30   1.9  
SB_36083| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.4  
SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5)            29   4.4  
SB_58549| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.9  
SB_36643| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.9  
SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.9  

>SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 20/24 (83%), Positives = 21/24 (87%)
 Frame = -1

Query: 422 DVVAVSQAPSPESNLDSPLPVTTM 351
           DVVAVSQAPSPESN +SP PV TM
Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128


>SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 21/28 (75%), Positives = 21/28 (75%)
 Frame = +2

Query: 2   LPVVICLSQRLSHACLSASRIKAIPRMA 85
           LPVVICLSQRLSHACLS S      RMA
Sbjct: 134 LPVVICLSQRLSHACLSISTCTVKLRMA 161


>SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 21/28 (75%), Positives = 21/28 (75%)
 Frame = +2

Query: 2   LPVVICLSQRLSHACLSASRIKAIPRMA 85
           LPVVICLSQRLSHACLS S      RMA
Sbjct: 110 LPVVICLSQRLSHACLSISTRTVKLRMA 137


>SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 212

 Score = 37.1 bits (82), Expect = 0.013
 Identities = 17/21 (80%), Positives = 18/21 (85%)
 Frame = -1

Query: 413 AVSQAPSPESNLDSPLPVTTM 351
           AVSQAPSPESN +SP PV TM
Sbjct: 52  AVSQAPSPESNPNSPSPVVTM 72


>SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 337

 Score = 35.1 bits (77), Expect = 0.051
 Identities = 15/17 (88%), Positives = 16/17 (94%)
 Frame = -2

Query: 412 PFLRLPLRNRTLIPRYP 362
           PFLRLPLRNRTLI R+P
Sbjct: 224 PFLRLPLRNRTLILRHP 240


>SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 180

 Score = 34.3 bits (75), Expect = 0.089
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = +2

Query: 503 EARNRNEYTLNILTRHNWRASLXXXXXXXXXXXXYTKIVTVKKLVVAF 646
           +   R    ++++ R +WRASL            Y K+V VKKLVV F
Sbjct: 47  QTTTRVHAAMHLVIRIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGF 94


>SB_595| Best HMM Match : CH (HMM E-Value=0)
          Length = 905

 Score = 32.3 bits (70), Expect = 0.36
 Identities = 15/33 (45%), Positives = 24/33 (72%), Gaps = 2/33 (6%)
 Frame = +3

Query: 378 KVRFRRGSLRNGYHIQGRQQA--RKLPTPGTGG 470
           +VR  RG++++GY+   +QQA  RK+P PG+ G
Sbjct: 328 EVRSNRGTIQSGYYFCKQQQAARRKIPKPGSIG 360


>SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22)
          Length = 1797

 Score = 31.9 bits (69), Expect = 0.48
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +3

Query: 12  LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 146
           L  CL D A+ ++ +    +Y  W+N+ +LV    L ++  CG+S
Sbjct: 447 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 491


>SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 31.9 bits (69), Expect = 0.48
 Identities = 16/34 (47%), Positives = 18/34 (52%)
 Frame = +2

Query: 545 RHNWRASLXXXXXXXXXXXXYTKIVTVKKLVVAF 646
           R +WRASL            Y K+V VKKLVV F
Sbjct: 14  RIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGF 47


>SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082)
          Length = 1304

 Score = 31.9 bits (69), Expect = 0.48
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +3

Query: 12   LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 146
            L  CL D A+ ++ +    +Y  W+N+ +LV    L ++  CG+S
Sbjct: 866  LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 910


>SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0)
          Length = 441

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = -1

Query: 431 PSLDVVAVSQAPSPESNLDSPLP 363
           P+ DV+A  Q P P S +D PLP
Sbjct: 75  PAEDVMAAHQEPKPTSAIDQPLP 97


>SB_36083| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 458

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +3

Query: 381 VRFRRGS-LRNGYHIQGRQQARKLPTPGTGGSDEK*RYGTLT 503
           VR +RG+ + + +H+   +   KL    TGGS ++ RY T+T
Sbjct: 227 VRIKRGADVASDHHLLVARLKLKLKKNWTGGSSQRQRYNTIT 268


>SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5)
          Length = 203

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 10/25 (40%), Positives = 12/25 (48%)
 Frame = -2

Query: 643 CNYELFNRNNFSIRYWSWNYRGCWH 569
           C   +  RN   +RYW W  R C H
Sbjct: 91  CEVTVIARNILPVRYWIWLSRKCGH 115


>SB_58549| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 447

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%)
 Frame = +3

Query: 330 DGSFCDYHGCHG*-RGIKVRFRRGSLRNGYHIQGRQQARKLPT 455
           +G    +H   G  R ++V FR G+L  G H+  R    ++PT
Sbjct: 327 EGGVVTFHAGQGRGRALRVHFRSGALPPGRHVVSRVLHPRMPT 369


>SB_36643| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 537

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +3

Query: 381 VRFRRGS-LRNGYHIQGRQQARKLPTPGTGGSDEK*RYGTLT 503
           VR +RG+ + + +H+   +   KL    TGGS ++ RY T+T
Sbjct: 140 VRVKRGADVASDHHLLVARLKLKLKKNWTGGSSKRQRYNTIT 181


>SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1077

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/35 (37%), Positives = 17/35 (48%)
 Frame = +2

Query: 221 EGLACEVVNFDDLDNFCRSHGQVPATHLSNVCLIN 325
           +G+ CE VN   L   C  H     T+ S+VC  N
Sbjct: 513 DGITCEDVNECQLPGSCHVHATCANTNGSHVCTCN 547


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,298,872
Number of Sequences: 59808
Number of extensions: 439467
Number of successful extensions: 1048
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 1003
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1048
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1693527500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).