SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0112
         (679 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_48014| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   9e-18
SB_43122| Best HMM Match : No HMM Matches (HMM E-Value=.)              68   6e-12
SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9)                   67   1e-11
SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2)                 59   3e-09
SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_55066| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_54550| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_54118| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_51190| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_48072| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_47125| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_44926| Best HMM Match : Attractin (HMM E-Value=7)                   59   3e-09
SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               59   3e-09
SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_43021| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_41868| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_41072| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_39827| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               59   3e-09
SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36156| Best HMM Match : Attractin (HMM E-Value=7)                   59   3e-09
SB_36112| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_35086| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               59   3e-09
SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1)               59   3e-09
SB_32963| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_29844| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_29785| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4)           59   3e-09
SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_23790| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_22505| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_21728| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6)             59   3e-09
SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1)               59   3e-09
SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_17415| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_17306| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               59   3e-09
SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7)           59   3e-09
SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_9120| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_8797| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_8779| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_8654| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_8464| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_8430| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_8410| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_8220| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_7764| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_7356| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_7349| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_7252| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_7157| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_7113| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_7085| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_6890| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_6616| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_6037| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_5934| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_5529| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_5295| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_5042| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_5041| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_4511| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_4433| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_4372| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_4226| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_4161| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_3964| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_3933| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_2907| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_2782| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_2639| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_2564| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_2174| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_2150| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_1538| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_1504| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_1281| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_1196| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   3e-09
SB_788| Best HMM Match : No HMM Matches (HMM E-Value=.)                59   3e-09
SB_721| Best HMM Match : No HMM Matches (HMM E-Value=.)                59   3e-09
SB_574| Best HMM Match : PapG_N (HMM E-Value=8)                        59   3e-09
SB_548| Best HMM Match : No HMM Matches (HMM E-Value=.)                59   3e-09
SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)                 59   3e-09
SB_172| Best HMM Match : No HMM Matches (HMM E-Value=.)                59   3e-09
SB_59785| Best HMM Match : TBCA (HMM E-Value=3)                        59   3e-09
SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_59546| Best HMM Match : Collagen (HMM E-Value=0.003)                59   3e-09
SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               59   3e-09
SB_59242| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2)                 59   3e-09
SB_59187| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_59131| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_59001| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_58964| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_58933| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_58264| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_57917| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_57878| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_57788| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_56857| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_56810| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_56195| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_56111| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_55984| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_55672| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_55664| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_55372| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_55221| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_54670| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_54625| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_54192| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_53956| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_53701| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_53637| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_53434| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_53249| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_52930| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_52839| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_52708| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_52332| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_52026| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_51920| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_51767| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_51579| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_51510| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               59   3e-09
SB_51154| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_50997| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_50427| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_50404| Best HMM Match : Pep_M12B_propep (HMM E-Value=6)             59   3e-09
SB_50393| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_50189| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_49781| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_49101| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_49042| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_48963| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_48957| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_48813| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_48453| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_48226| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_47917| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_47720| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_47666| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_47427| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_47350| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_46769| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_46630| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_46329| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_46320| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_46081| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_45450| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_45197| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_45018| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_44709| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_44370| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9)           59   3e-09
SB_44174| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_44053| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_43619| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_43572| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_43409| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_42784| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_42287| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_42013| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.8)           59   3e-09
SB_41701| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_41333| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_41310| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_41155| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_41098| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_40781| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_40467| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_40329| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_40150| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_40121| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               59   3e-09
SB_40085| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_39869| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_39718| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_39341| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_38615| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_38278| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_37993| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_37765| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_37658| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_37587| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_37564| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_37354| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_37287| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_37073| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36965| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36882| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36869| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36786| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36725| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36717| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36657| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36525| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36394| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36031| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_35815| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_35712| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_35515| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_35475| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_35434| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_35346| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_35321| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_34616| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_34440| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_34397| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_34379| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_34378| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_34023| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_33989| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_33474| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_33416| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_33328| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_33170| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_32512| Best HMM Match : Chlam_OMP3 (HMM E-Value=4.2)                59   3e-09
SB_32361| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_32275| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_32095| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_32014| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_31990| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_31973| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_31926| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_31716| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_31547| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_31521| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_30243| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_30141| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_29925| Best HMM Match : GYF (HMM E-Value=6.8)                       59   3e-09
SB_29531| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_29169| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_28227| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_28224| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_27489| Best HMM Match : Pep_M12B_propep (HMM E-Value=4.7)           59   3e-09
SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021)               59   3e-09
SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_26909| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_26861| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8)                    59   3e-09
SB_26658| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_25285| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_25254| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_25043| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_24889| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_24879| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_24857| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_24789| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_24551| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_24500| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_24211| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_23617| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_23470| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_23311| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_23121| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_22956| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_22358| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_22112| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               59   3e-09
SB_21855| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_21849| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_21590| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_21571| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_21260| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_21251| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_21239| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_21222| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_21067| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_20387| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_20159| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09

>SB_48014| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 87.4 bits (207), Expect = 9e-18
 Identities = 41/54 (75%), Positives = 42/54 (77%)
 Frame = +3

Query: 435 GEQSNAWRILLRNDRKSRHRRIKKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           GEQSN WRILLRNDRKSRHRRIKK    +AWL QASYPCGNFS TS  KL   K
Sbjct: 2   GEQSNTWRILLRNDRKSRHRRIKKQRRYDAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 20/60 (33%), Positives = 27/60 (45%)
 Frame = +2

Query: 500 QKARRYERLAXTSQXXXXXXXXXXXXXXXYTKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           +K RRY+     +                 TKGS+G AF V + TE+ +Q SF PF   E
Sbjct: 24  KKQRRYDAWLPQASYPCGNFSDTSSLKLLKTKGSVGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_43122| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 68.1 bits (159), Expect = 6e-12
 Identities = 31/35 (88%), Positives = 32/35 (91%)
 Frame = -1

Query: 496 LRCRLFLSLRSKIRQALDCSPIKRERELGLDRRET 392
           LRCRLFLSLRS+IRQ LDCSP  RERELGLDRRET
Sbjct: 15  LRCRLFLSLRSRIRQVLDCSPTNRERELGLDRRET 49


>SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9)
          Length = 321

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 30/40 (75%), Positives = 32/40 (80%)
 Frame = +3

Query: 432 MGEQSNAWRILLRNDRKSRHRRIKKHVAMNAWLXQASYPC 551
           +GEQSN WRILLRNDRKS     K +VAMNAWL QASYPC
Sbjct: 97  VGEQSNTWRILLRNDRKSDIEGSKSNVAMNAWLPQASYPC 136


>SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2)
          Length = 196

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55


>SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 2   WVNNPTLGEFCFAMIGRADIEGSKS 26



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 25  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 55  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 84


>SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_55066| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKS 63



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93


>SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVGIHTENQNQVSFYPFVLHE 83


>SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_54550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 20/24 (83%), Positives = 21/24 (87%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTS 572
           K +VAMNAWL QASYPCGNFS TS
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTS 47



 Score = 34.7 bits (76), Expect = 0.070
 Identities = 16/30 (53%), Positives = 19/30 (63%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG  F V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHTFTVCIHTENQNQVSFYPFVLHE 83


>SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_54118| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGS+G AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSVGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_51190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKS 63



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 92  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 121


>SB_48072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_47125| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKS 63



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93


>SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 40  WVNNPTLGEFCFAMIGRADIEGSKS 64



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 63  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 93  TKGSIGHAFTVCIHTENQNQVSFFPFVLHE 122


>SB_44926| Best HMM Match : Attractin (HMM E-Value=7)
          Length = 111

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKS 63



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93


>SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 179

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55


>SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_43021| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 2   WVNNPTLGEFCFAMIGRADIEGSKS 26



 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 22/32 (68%), Positives = 23/32 (71%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGN S TS  KL   K
Sbjct: 25  KSNVAMNAWLPQASYPCGNLSDTSSLKLLKTK 56



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 55  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 84


>SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_41868| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 22/32 (68%), Positives = 23/32 (71%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +V MNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVPMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_41072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKS 63



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93


>SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKS 63



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 92  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 121


>SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_39827| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 70  WVNNPTLGEFCFAMIGRADIEGSKS 94



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 93  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 124



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 123 TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 152


>SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 179

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 22/32 (68%), Positives = 23/32 (71%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPC NFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCRNFSDTSSLKLLKTK 55


>SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGS+G AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSVGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_36156| Best HMM Match : Attractin (HMM E-Value=7)
          Length = 162

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKS 63



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 92  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 121


>SB_36112| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 79

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKS 63



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 14/17 (82%), Positives = 15/17 (88%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPC 551
           K +VAMNAWL QASYPC
Sbjct: 62  KSNVAMNAWLPQASYPC 78


>SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 164

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 70  WVNNPTLGEFCFAMIGRADIEGSKS 94



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 93  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 124


>SB_35086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKS 63



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93


>SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 179

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55


>SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 40  WVNNPTLGEFCFAMIGRADIEGSKS 64



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 63  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 93  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 122


>SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1)
          Length = 471

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKS 63



 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 348 WVNNPTLGEFCFAMIGRADIEGSKS 372



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 371 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 402



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 401 TKGSIGHAFTVCIHTENHNQVSFYPFVLHE 430


>SB_32963| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 16/30 (53%), Positives = 19/30 (63%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSI  AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIAHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 2   WVNNPTLGEFCFAMIGRADIEGSKS 26



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 25  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 55  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 84


>SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFPVCIHTENQNQVSFYPFVLHE 83


>SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 40  WVNNPTLGEFCFAMIGRADIEGSKS 64



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 63  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 93  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 122


>SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 22/32 (68%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGN+S TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNYSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_29844| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 52

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25


>SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_29785| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4)
          Length = 128

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKS 63



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 92  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 121


>SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_23790| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 2   WVNNPTLGEFCFAMIGRADIEGSKS 26



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 25  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 16/30 (53%), Positives = 19/30 (63%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q S  PF   E
Sbjct: 55  TKGSIGHAFTVCIHTENQNQVSSYPFVLHE 84


>SB_22505| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 22/32 (68%), Positives = 23/32 (71%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS T   KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTCSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 2   WVNNPTLGEFCFAMIGRADIEGSKS 26



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 25  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 55  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 84


>SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_21728| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 19  WVNNPTLGEFCFAMIGRADIEGSKS 43



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 42  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 73



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 72  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 101


>SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6)
          Length = 128

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1)
          Length = 276

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 153 WVNNPTLGEFCFAMIGRADIEGSKS 177



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 176 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 207



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 206 TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 235


>SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKS 63



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 92  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 121


>SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_17415| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_17306| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 80

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 40  WVNNPTLGEFCFAMIGRADIEGSKS 64



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 14/17 (82%), Positives = 15/17 (88%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPC 551
           K +VAMNAWL QASYPC
Sbjct: 63  KSNVAMNAWLPQASYPC 79


>SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 248

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 70  WVNNPTLGEFCFAMIGRADIEGSKS 94



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 93  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 124


>SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 32  WVNNPTLGEFCFAMIGRADIEGSKS 56



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 55  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 86



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 85  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 114


>SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7)
          Length = 207

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 70  WVNNPTLGEFCFAMIGRADIEGSKS 94



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 93  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 124



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 123 TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 152


>SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQESFYPFVLHE 83


>SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 35.1 bits (77), Expect = 0.053
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGS+G AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSMGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


>SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 25/25 (100%), Positives = 25/25 (100%)
 Frame = +1

Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507
           WVNNPTLGEFCFAMIGRADIEGSKS
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKS 25



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/32 (71%), Positives = 24/32 (75%)
 Frame = +3

Query: 501 KKHVAMNAWLXQASYPCGNFSGTSC*KLFILK 596
           K +VAMNAWL QASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/30 (56%), Positives = 20/30 (66%)
 Frame = +2

Query: 590 TKGSIGRAFAVPMRTEHLDQASFCPFAPRE 679
           TKGSIG AF V + TE+ +Q SF PF   E
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,566,530
Number of Sequences: 59808
Number of extensions: 434677
Number of successful extensions: 3243
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 1759
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3240
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1745338465
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).