SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0110
         (490 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   4e-05
SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.001
SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.29 
SB_1848| Best HMM Match : Galactosyl_T (HMM E-Value=1.4e-26)           31   0.67 
SB_54195| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   0.89 
SB_6393| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-28)                  28   3.6  
SB_46486| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.7)            28   3.6  
SB_34438| Best HMM Match : Ribosomal_L23eN (HMM E-Value=2)             27   8.3  

>SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 38

 Score = 44.8 bits (101), Expect = 4e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = -2

Query: 249 NRYGPPSGFPLTAT*PGIVHHLSGPSICA 163
           NRY PP  FPL +   GIVHHLSGP+ CA
Sbjct: 1   NRYEPPPEFPLASPYSGIVHHLSGPNRCA 29


>SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 112

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 24/44 (54%), Positives = 30/44 (68%)
 Frame = -1

Query: 250 ESLRSSIRVSPDCDLTRHSSPSFGSQHLCSERAFIH*LETSRLG 119
           ESLR+S RVS    L RHSSPSFGSQ +   R++ + L  SR+G
Sbjct: 35  ESLRASTRVSSGFTLFRHSSPSFGSQQM---RSYSN-LSKSRIG 74


>SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 91

 Score = 31.9 bits (69), Expect = 0.29
 Identities = 13/21 (61%), Positives = 14/21 (66%)
 Frame = -2

Query: 249 NRYGPPSGFPLTAT*PGIVHH 187
           NRY PP  FPL +   GIVHH
Sbjct: 1   NRYEPPPEFPLASPYSGIVHH 21


>SB_1848| Best HMM Match : Galactosyl_T (HMM E-Value=1.4e-26)
          Length = 308

 Score = 30.7 bits (66), Expect = 0.67
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = +1

Query: 169 NAGTRKMVNYAWSGRSQGKP*WRTVAILTANRSSE 273
           NA  RK + + W       P WRTV ++ AN + E
Sbjct: 75  NAARRKEIRFTWGTDFLPSPRWRTVFLIGANDNQE 109


>SB_54195| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 370

 Score = 30.3 bits (65), Expect = 0.89
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = +1

Query: 169 NAGTRKMVNYAWSGRSQGKP*WRTVAILTANRSSE 273
           NA  RK + + W       P WRTV ++ AN + E
Sbjct: 79  NAARRKEIRFTWGTDFLPTPRWRTVFLIGANDNQE 113


>SB_6393| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-28)
          Length = 307

 Score = 28.3 bits (60), Expect = 3.6
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -2

Query: 195 VHHLSGPSICAQSAPSFTDWKRAASGVRKSR 103
           V  L+  S+C Q APSF + K+ AS VR ++
Sbjct: 183 VRKLAKISLCDQYAPSFKEKKKMASEVRVAK 213


>SB_46486| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.7)
          Length = 703

 Score = 28.3 bits (60), Expect = 3.6
 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
 Frame = +3

Query: 156 RSEHKCWDPKD--GELCLVRSQSGETLMEDRSDSDCKSIVGTGYRGERLIEPSSSWVRPK 329
           +++  C D ++  GE     ++S +T   D S + C+S++ TG   + L +   S  RP+
Sbjct: 303 QNDLSCSDSENEGGESFSTTAKSKDTKANDYSMTSCRSVLATGLNEQSLAKRKESIRRPE 362


>SB_34438| Best HMM Match : Ribosomal_L23eN (HMM E-Value=2)
          Length = 772

 Score = 27.1 bits (57), Expect = 8.3
 Identities = 13/38 (34%), Positives = 22/38 (57%)
 Frame = -3

Query: 332 KLRTDPATRWFD*SFAPIPSSDDRFAVRIATVLHQGFP 219
           K   DP+++ F   F  IPS +D+ A+ + + LH+  P
Sbjct: 28  KALDDPSSQ-FGNDFKAIPSEEDKRAMHLQSALHRSEP 64


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,418,737
Number of Sequences: 59808
Number of extensions: 302715
Number of successful extensions: 1335
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1293
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1335
length of database: 16,821,457
effective HSP length: 77
effective length of database: 12,216,241
effective search space used: 1038380485
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).