SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0109
         (498 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_863| Best HMM Match : C2 (HMM E-Value=5.4e-36)                      62   3e-10
SB_50693| Best HMM Match : C2 (HMM E-Value=0)                          53   2e-07
SB_45184| Best HMM Match : C2 (HMM E-Value=1.1e-22)                    52   3e-07
SB_43325| Best HMM Match : C2 (HMM E-Value=1.1e-22)                    52   3e-07
SB_20559| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   3e-07
SB_6033| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=1.6e-37)         52   3e-07
SB_41604| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   3e-07
SB_3985| Best HMM Match : C2 (HMM E-Value=0)                           49   2e-06
SB_19229| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   8e-06
SB_4929| Best HMM Match : C2 (HMM E-Value=2.4e-33)                     46   1e-05
SB_27807| Best HMM Match : C2 (HMM E-Value=0)                          46   2e-05
SB_3666| Best HMM Match : No HMM Matches (HMM E-Value=.)               46   2e-05
SB_40281| Best HMM Match : C2 (HMM E-Value=6.7e-39)                    46   2e-05
SB_794| Best HMM Match : C2 (HMM E-Value=1e-23)                        42   2e-04
SB_29967| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_3618| Best HMM Match : C2 (HMM E-Value=4.8e-23)                     42   4e-04
SB_2344| Best HMM Match : No HMM Matches (HMM E-Value=.)               41   5e-04
SB_50691| Best HMM Match : C2 (HMM E-Value=2.8e-17)                    41   7e-04
SB_59727| Best HMM Match : C2 (HMM E-Value=0.0018)                     40   9e-04
SB_16861| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_11279| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.002
SB_49531| Best HMM Match : C2 (HMM E-Value=2.9e-13)                    38   0.003
SB_40174| Best HMM Match : Copine (HMM E-Value=5.5e-20)                38   0.006
SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.006
SB_1629| Best HMM Match : C2 (HMM E-Value=7.3e-17)                     38   0.006
SB_21545| Best HMM Match : FerB (HMM E-Value=3.1e-30)                  37   0.008
SB_10754| Best HMM Match : C2 (HMM E-Value=5.1e-40)                    36   0.019
SB_1933| Best HMM Match : PI3_PI4_kinase (HMM E-Value=4.06377e-44)     36   0.025
SB_45192| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.057
SB_3986| Best HMM Match : C2 (HMM E-Value=2.9e-31)                     33   0.099
SB_56890| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.17 
SB_28583| Best HMM Match : C2 (HMM E-Value=2.7e-17)                    31   0.40 
SB_34190| Best HMM Match : MAM (HMM E-Value=0)                         31   0.53 
SB_58025| Best HMM Match : C2 (HMM E-Value=0.0016)                     31   0.53 
SB_17935| Best HMM Match : C2 (HMM E-Value=6.1e-07)                    31   0.70 
SB_16478| Best HMM Match : C2 (HMM E-Value=2.2e-13)                    30   0.92 
SB_22143| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.6  
SB_30502| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.1  
SB_23139| Best HMM Match : Flotillin (HMM E-Value=0.11)                28   3.7  
SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.9  
SB_18049| Best HMM Match : C2 (HMM E-Value=3.2)                        28   4.9  
SB_48082| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.5  
SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.6  
SB_15237| Best HMM Match : NHL (HMM E-Value=0)                         27   8.6  
SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43)           27   8.6  
SB_8486| Best HMM Match : Granulin (HMM E-Value=0)                     27   8.6  
SB_7181| Best HMM Match : C2 (HMM E-Value=1.2e-15)                     27   8.6  

>SB_863| Best HMM Match : C2 (HMM E-Value=5.4e-36)
          Length = 454

 Score = 61.7 bits (143), Expect = 3e-10
 Identities = 29/77 (37%), Positives = 48/77 (62%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           ++ VEV EA +L+P DPNGLSDP+V + L+   +++ +  T +   +L+PV+ E F   +
Sbjct: 112 IMRVEVREARNLMPMDPNGLSDPYVKVKLLPDPDNTSKKKTKIFKESLSPVFNETFEFKI 171

Query: 433 SGTVNEDSLCLEVWDFD 483
                +  L +EVWD+D
Sbjct: 172 QNKDKDRRLSIEVWDWD 188


>SB_50693| Best HMM Match : C2 (HMM E-Value=0)
          Length = 1049

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 29/74 (39%), Positives = 41/74 (55%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + V V+   +LV  D  G SDPFVT  +      ++ + V   TLNPVW E  S+ +S  
Sbjct: 609 IQVSVLRGRNLVAMDITGKSDPFVTFRV--GDQEKFRSRVHQKTLNPVWME--SVALSLP 664

Query: 442 VNEDSLCLEVWDFD 483
            ++D L L+VWD D
Sbjct: 665 ADDDKLYLDVWDKD 678



 Score = 43.2 bits (97), Expect = 1e-04
 Identities = 23/66 (34%), Positives = 35/66 (53%)
 Frame = +1

Query: 292 LVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEV 471
           ++P D NGLSDP+  +Y  +N +    T V   TL+PVW      P++    + +L   V
Sbjct: 486 MIPMDKNGLSDPYCVVY--ANRNLVKKTEVAKETLDPVWNAMVEFPVA-NFTQVTLSFAV 542

Query: 472 WDFDPA 489
           +D D A
Sbjct: 543 FDKDDA 548


>SB_45184| Best HMM Match : C2 (HMM E-Value=1.1e-22)
          Length = 344

 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244 RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           R SG+  L V +VE  DL   DP+G+SDP+  +   S  S  + T V   TLNP W    
Sbjct: 262 RTSGIGKLVVTIVEGVDLKSSDPSGMSDPYCEV---SMGSQEHKTRVCPQTLNPKWNSTM 318

Query: 421 SLPMSGTVNEDSLCLEVWDFD 483
           +  +   + +D LC+ V+D D
Sbjct: 319 TFTVK-DMEQDVLCITVFDRD 338


>SB_43325| Best HMM Match : C2 (HMM E-Value=1.1e-22)
          Length = 87

 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244 RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           R SG+  L V +VE  DL   DP+G+SDP+  +   S  S  + T V   TLNP W    
Sbjct: 5   RTSGIGKLVVTIVEGVDLKSSDPSGMSDPYCEV---SMGSQEHKTRVCPQTLNPKWNSTM 61

Query: 421 SLPMSGTVNEDSLCLEVWDFD 483
           +  +   + +D LC+ V+D D
Sbjct: 62  TFTVK-DMEQDVLCITVFDRD 81


>SB_20559| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 351

 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244 RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           R SG+  L V +VE  DL   DP+G+SDP+  +   S  S  + T V   TLNP W    
Sbjct: 218 RTSGIGKLVVTIVEGVDLKSSDPSGMSDPYCEV---SMGSQEHKTRVCPQTLNPKWNSTM 274

Query: 421 SLPMSGTVNEDSLCLEVWDFD 483
           +  +   + +D LC+ V+D D
Sbjct: 275 TFTVK-DMEQDVLCITVFDRD 294


>SB_6033| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=1.6e-37)
          Length = 1052

 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244  RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
            R SG+  L V +VE  DL   DP+G+SDP+  +   S  S  + T V   TLNP W    
Sbjct: 927  RTSGIGKLVVTIVEGVDLKSSDPSGMSDPYCEV---SMGSQEHKTRVCPQTLNPKWNSTM 983

Query: 421  SLPMSGTVNEDSLCLEVWDFD 483
            +  +   + +D LC+ V+D D
Sbjct: 984  TFTVK-DMEQDVLCITVFDRD 1003


>SB_41604| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 406

 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +1

Query: 244 RASGL-MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           R SG+  L V +VE  DL   DP+G+SDP+  +   S  S  + T V   TLNP W    
Sbjct: 262 RTSGIGKLVVTIVEGVDLKSSDPSGMSDPYCEV---SMGSQEHKTRVCPQTLNPKWNSTM 318

Query: 421 SLPMSGTVNEDSLCLEVWDFD 483
           +  +   + +D LC+ V+D D
Sbjct: 319 TFTVK-DMEQDVLCITVFDRD 338


>SB_3985| Best HMM Match : C2 (HMM E-Value=0)
          Length = 835

 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 4/81 (4%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKD----PNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           +L V+VVEA DLV KD      G SDP+  + +    + ++ T VK   LNP W E F  
Sbjct: 364 VLRVKVVEARDLVAKDFGVVKKGKSDPYAILEI---GAQKFRTKVKKNDLNPTWNETFEA 420

Query: 427 PMSGTVNEDSLCLEVWDFDPA 489
            +  +  +D + + +WD D A
Sbjct: 421 FVDNSEGQD-IDMFLWDEDKA 440



 Score = 30.3 bits (65), Expect = 0.92
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 6/65 (9%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM---SNSSHRYNTSVK---SGTLNPVWEEHFS 423
           L V+V+ A +L   D    ++PFV +YL+   S  + R   +V+   SG  N V+E    
Sbjct: 726 LVVKVISARNLRSGDAENKTNPFVRLYLLPDRSKKTRRVTKTVRGAYSGMFNEVFEYAIG 785

Query: 424 LPMSG 438
           L + G
Sbjct: 786 LDLLG 790


>SB_19229| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 338

 Score = 47.2 bits (107), Expect = 8e-06
 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 3/77 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSS--HRYNTSVKSGTLNPVWEEHFSLPMS 435
           L + +VEA  L   D  G SDP+V I L+       +  T+VK  TLNP + E F+  ++
Sbjct: 218 LQITIVEAKSLKSMDLTGYSDPYVKIALVQEGRKIKKKKTTVKKRTLNPYYNETFTFTVA 277

Query: 436 -GTVNEDSLCLEVWDFD 483
              + + SL + V D+D
Sbjct: 278 FEKIEQTSLIISVLDYD 294


>SB_4929| Best HMM Match : C2 (HMM E-Value=2.4e-33)
          Length = 567

 Score = 46.4 bits (105), Expect = 1e-05
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 4/80 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEH--FSLP 429
           L+V ++EA +L  KD +G+SDPF  I L+       R+ T++   TLNP W+ +  +   
Sbjct: 430 LHVHIMEAKNLPGKDADGMSDPFCKITLLPDKKGKTRHKTAIIKRTLNPSWDYNLIYEEL 489

Query: 430 MSGTVNEDSLCLEVWDFDPA 489
               + +  L + +WD D A
Sbjct: 490 SQEELRQRVLEISIWDHDIA 509


>SB_27807| Best HMM Match : C2 (HMM E-Value=0)
          Length = 405

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +1

Query: 310 NGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS---LPMSGTVNEDSLCLEVWDF 480
           +G SDPFV I L+ +  H+  T VK   LNPVW E F+    P +  + + +L ++V D+
Sbjct: 157 SGTSDPFVKIMLLPDKKHKLETRVKRKNLNPVWNEVFTFEGFPHNKLMGK-TLYMQVLDY 215

Query: 481 D 483
           D
Sbjct: 216 D 216



 Score = 41.1 bits (92), Expect = 5e-04
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLPMS 435
           V V++A  L   D  G SDP+V +Y+M       +  T++K  T +PVW E   F +P+ 
Sbjct: 275 VVVMKANKLKAMDLTGSSDPYVKMYIMHKDRRLDKKKTTIKRRTRDPVWNESFIFDVPLD 334

Query: 436 GTVNEDSLCLEVWDFD 483
             + + +    V D+D
Sbjct: 335 -KIRDLTFVFNVMDYD 349


>SB_3666| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 843

 Score = 46.0 bits (104), Expect = 2e-05
 Identities = 25/74 (33%), Positives = 38/74 (51%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L++E+ E  DL  +D  G SDP+V     ++    Y +   S  LNP W E F +P+   
Sbjct: 133 LDIELKEGKDLAARDKTGTSDPYVKF--KADGRQIYKSRTISKNLNPQWNEKFCVPIEDI 190

Query: 442 VNEDSLCLEVWDFD 483
                + L+V+DFD
Sbjct: 191 T--VPMVLKVFDFD 202



 Score = 42.3 bits (95), Expect = 2e-04
 Identities = 19/58 (32%), Positives = 31/58 (53%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           ++++ +VE   ++P D +G SDP+    L    + +Y +     TLNP W E F L M
Sbjct: 275 IVSIILVEGKKMIPMDDSGFSDPYCRFRL---GNEKYKSKACKETLNPQWSEQFDLKM 329



 Score = 34.7 bits (76), Expect = 0.043
 Identities = 24/74 (32%), Positives = 36/74 (48%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V++  A  L   D  G SDPF  I +   ++ R  T+    TLNP W + + +P+   
Sbjct: 470 LQVKLHRAVGLASADLGGASDPFAVIEV---NNQRLVTNTIYKTLNPNWNKIYEMPVWDI 526

Query: 442 VNEDSLCLEVWDFD 483
              D L + V+D D
Sbjct: 527 --HDVLDITVFDED 538


>SB_40281| Best HMM Match : C2 (HMM E-Value=6.7e-39)
          Length = 230

 Score = 45.6 bits (103), Expect = 2e-05
 Identities = 29/78 (37%), Positives = 38/78 (48%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLP-- 429
           L V + EA +L  KD NG SDPFV  YL+ +     +  T      LNP W   F+    
Sbjct: 95  LQVVIKEARNLPAKDANGFSDPFVKAYLLPDKGRKSKRKTPTIRKNLNPQWNFPFTYDDV 154

Query: 430 MSGTVNEDSLCLEVWDFD 483
               + + SL L VWD+D
Sbjct: 155 TLEELMDRSLELTVWDWD 172


>SB_794| Best HMM Match : C2 (HMM E-Value=1e-23)
          Length = 583

 Score = 42.3 bits (95), Expect = 2e-04
 Identities = 20/60 (33%), Positives = 32/60 (53%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L + VVE  +L   DPNG SDP+    +++       T+V+  T+NP W E     ++G
Sbjct: 50  LLTITVVEGRNLPVMDPNGKSDPYC---IVAVGDQEQRTAVQYNTINPEWRETLQFEVAG 106


>SB_29967| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 221

 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 2/77 (2%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF--SLPM 432
           ML V V+ A+DL   +  G SDP+V +  + +      T V    LNPVW E F   L  
Sbjct: 1   MLRVVVISASDLPNVETVGKSDPYVVVGFLGSKK---KTEVIKDELNPVWNEKFEWDLQK 57

Query: 433 SGTVNEDSLCLEVWDFD 483
                ++SL ++V D++
Sbjct: 58  RALSPDESLHIQVKDWE 74


>SB_3618| Best HMM Match : C2 (HMM E-Value=4.8e-23)
          Length = 486

 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 25/81 (30%), Positives = 46/81 (56%), Gaps = 6/81 (7%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKD-PNGLSDPFVTIYLMSN--SSHRYNTSVKSGTLNPVWE--EHFSL 426
           L V+V++  +L P+D P+G +DP+V + +  +  +S    +++  GTLNP W   E +  
Sbjct: 27  LMVKVLQGRNLSPRDLPSGTADPYVLVAIQPDWGNSGTLKSTIIQGTLNPTWPFGEIYRF 86

Query: 427 PMS-GTVNEDSLCLEVWDFDP 486
            +S   + E  L + ++D DP
Sbjct: 87  NLSPEQLKETKLSVHLYDNDP 107


>SB_2344| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 388

 Score = 41.1 bits (92), Expect = 5e-04
 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 6/80 (7%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           L+V + +A  L P D  G SDP+V ++L+  ++ S++  +  K  TLNPV+ E  +L   
Sbjct: 18  LDVVLHDAKGLKPMDHGGTSDPYVKLHLLPGASKSNKLRSHTKYKTLNPVFNE--TLTYY 75

Query: 436 GTVNED----SLCLEVWDFD 483
           G   E+    +L L+V+D D
Sbjct: 76  GITEEEISSKTLRLQVFDED 95


>SB_50691| Best HMM Match : C2 (HMM E-Value=2.8e-17)
          Length = 430

 Score = 40.7 bits (91), Expect = 7e-04
 Identities = 27/78 (34%), Positives = 42/78 (53%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           SG++L V +   + L+  D +G SDP+  I   SN      TSV  GT+NPVW+    + 
Sbjct: 289 SGVLL-VALHSGSKLLSMDADGYSDPYCII--TSNREKVKTTSVVEGTVNPVWDSITEI- 344

Query: 430 MSGTVNEDSLCLEVWDFD 483
           +   +N+ +L   V+D D
Sbjct: 345 LVKDINKTNLHFFVYDRD 362


>SB_59727| Best HMM Match : C2 (HMM E-Value=0.0018)
          Length = 482

 Score = 40.3 bits (90), Expect = 9e-04
 Identities = 18/49 (36%), Positives = 30/49 (61%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPV 405
           +L V+V+ A DLVP+D NG SDP+V + L+ + +  +  S  +   N +
Sbjct: 407 LLLVKVIRARDLVPRDLNGKSDPYVVLELVPDRNSDFLASTPNSNSNSI 455


>SB_16861| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2214

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVW 408
            ++ V ++ A DL P+DP GL+DP+V + L            K  TLNP++
Sbjct: 1722 VVRVYILSAIDLQPQDPGGLADPYVVVQLGKKKLDN-KDQYKPNTLNPIF 1770


>SB_11279| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 108

 Score = 39.1 bits (87), Expect = 0.002
 Identities = 17/46 (36%), Positives = 30/46 (65%), Gaps = 2/46 (4%)
 Frame = +1

Query: 289 DLVPKDPNGLSDPFVTIYLM--SNSSHRYNTSVKSGTLNPVWEEHF 420
           DL+P D +GL+DP++  Y++   + S+R  T +   TL+P ++E F
Sbjct: 2   DLMPCDSDGLADPYMRSYVLPDKSKSNRRRTDIAKNTLSPSFDEKF 47


>SB_49531| Best HMM Match : C2 (HMM E-Value=2.9e-13)
          Length = 752

 Score = 38.3 bits (85), Expect = 0.003
 Identities = 20/69 (28%), Positives = 35/69 (50%)
 Frame = +1

Query: 277 VEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDS 456
           ++A  L  K+  G   P+  I    N   R  TS+   T NP W E+F+L ++    E  
Sbjct: 2   IKAMGLTSKEHGGNISPYCIIST-GNPHQRKRTSLLKDTHNPFWNEYFALDINSKTRE-- 58

Query: 457 LCLEVWDFD 483
           L ++++D++
Sbjct: 59  LTIDIYDYE 67


>SB_40174| Best HMM Match : Copine (HMM E-Value=5.5e-20)
          Length = 723

 Score = 37.5 bits (83), Expect = 0.006
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 6/67 (8%)
 Frame = +1

Query: 301 KDPNGLSDPFVTIYLMSNSSHR---YNTSVKSGTLNPVWEEHFSLPMSGTVNED---SLC 462
           KD  G SDPF+  Y  +  +     + T V   TLNP W+  FS+P     N D   S+ 
Sbjct: 84  KDFFGKSDPFLVFYRCNEDNSFTAVHRTEVVKNTLNPTWKP-FSVPARALCNGDIDRSIR 142

Query: 463 LEVWDFD 483
           +E +D+D
Sbjct: 143 IECYDWD 149


>SB_28690| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2179

 Score = 37.5 bits (83), Expect = 0.006
 Identities = 29/79 (36%), Positives = 39/79 (49%), Gaps = 4/79 (5%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS- 435
           ML V V  A +L   D  G SDP+V +   S       T V    LNPVW+E      S 
Sbjct: 1   MLRVVVKSAVNLPNVDFRGESDPYVKL---SFRGEEKKTKVIDDNLNPVWDEDNEFEWSL 57

Query: 436 --GTVN-EDSLCLEVWDFD 483
             GT++ +D+L + V D+D
Sbjct: 58  GGGTLSLDDTLKVSVKDWD 76


>SB_1629| Best HMM Match : C2 (HMM E-Value=7.3e-17)
          Length = 327

 Score = 37.5 bits (83), Expect = 0.006
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +1

Query: 274 VVEATDLVPKD-PNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNE 450
           +++  DL  KD     S P+V IY + +  H + T++ +  LNP + E F +     +  
Sbjct: 158 ILQCRDLPAKDLRRNTSSPYVRIYALPSRRHNHRTNIVTNNLNPTFNELFIISGLTLMEV 217

Query: 451 DSLCLEV 471
             L L++
Sbjct: 218 QQLALQI 224


>SB_21545| Best HMM Match : FerB (HMM E-Value=3.1e-30)
          Length = 1142

 Score = 37.1 bits (82), Expect = 0.008
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 8/85 (9%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF---SLPM 432
           L   + +A DL+  DP+G+SDP+  +   + SS    T   + TL P W++      + +
Sbjct: 346 LRAYLFQARDLLASDPDGVSDPYARVVFGTRSS---VTETLARTLCPTWDQTLIFDEVNI 402

Query: 433 SGTV-----NEDSLCLEVWDFDPAE 492
            G++     N  ++ +E++D DP +
Sbjct: 403 YGSIEQVAENPPAVIIELYDKDPVD 427


>SB_10754| Best HMM Match : C2 (HMM E-Value=5.1e-40)
          Length = 2057

 Score = 35.9 bits (79), Expect = 0.019
 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 2/76 (2%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEH--FSLPMS 435
           L V+++ AT L PK  N ++ P+V + L+ +   +  ++ +    NP + E   FS+P +
Sbjct: 279 LQVKLIRATRLTPKGNNVVATPYVKMCLLPDRKRKLQSTRRHRNSNPAFNEDFVFSVP-A 337

Query: 436 GTVNEDSLCLEVWDFD 483
             +   +L   V DFD
Sbjct: 338 EELRMRTLKFTVCDFD 353


>SB_1933| Best HMM Match : PI3_PI4_kinase (HMM E-Value=4.06377e-44)
          Length = 915

 Score = 35.5 bits (78), Expect = 0.025
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEH--FSLP 429
            L V V+ A DL  ++ +   DP+V +YL+ + S   +  T +   + NP + E   +S  
Sbjct: 803  LRVMVMHAKDLSSRNSSTAGDPYVKLYLLPDPSKTTKLKTKIAKKSQNPTYNETLVYSNL 862

Query: 430  MSGTVNEDSLCLEVWDFD 483
             +  +    L + VWD D
Sbjct: 863  SAADLKTRHLQVTVWDHD 880


>SB_45192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 634

 Score = 34.3 bits (75), Expect = 0.057
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 3/78 (3%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLS--DPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP- 429
           +L V +++A +L P D       +PF  + L  +  H+  + V+  T NP ++E F    
Sbjct: 385 VLTVRLIKAINLSPLDGEWSKPCNPFAIVQLQPDYQHQLQSYVQRKTTNPNFDETFEFEV 444

Query: 430 MSGTVNEDSLCLEVWDFD 483
           +   +   SLC+ +  FD
Sbjct: 445 LVQELQRLSLCITLHSFD 462


>SB_3986| Best HMM Match : C2 (HMM E-Value=2.9e-31)
          Length = 778

 Score = 33.5 bits (73), Expect = 0.099
 Identities = 17/57 (29%), Positives = 29/57 (50%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFDPA 489
           SDP+  + +    + +Y T  K    +PVW+E F   +  T  ++  C +V+D D A
Sbjct: 300 SDPYCIVEV---GAQKYRTKTKKSNCDPVWKETFEAFIDNTEGQELFC-KVYDEDIA 352



 Score = 27.9 bits (59), Expect = 4.9
 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 2/53 (3%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEE 414
           L + ++ A  L  + P   ++PFV +YL+ + +   R  T    G+L P + E
Sbjct: 635 LLINIIRAERLRSRYPENKTNPFVRLYLLPDRTKKTRRRTGAVRGSLAPSFNE 687


>SB_56890| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1665

 Score = 32.7 bits (71), Expect = 0.17
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 1/77 (1%)
 Frame = +1

Query: 256  LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
            +++ V VV+A +L P D NG +DP++ + L      R   +  S  LNP +   F     
Sbjct: 1350 VLVRVYVVKALNLHPSDVNGKADPYLVVNL-GKHRVRDRDNYVSKQLNPTFGRCFE--FE 1406

Query: 436  GTVNEDS-LCLEVWDFD 483
              +  DS L + ++D+D
Sbjct: 1407 AIIPMDSMLTVGIYDWD 1423



 Score = 28.3 bits (60), Expect = 3.7
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           SGLM NV+     ++       L +P+V +     + HR  T+VK  T  P W E
Sbjct: 390 SGLMANVKKAFTGEV-----RDLVNPYVEVQF---AGHRARTTVKKNTYEPKWNE 436


>SB_28583| Best HMM Match : C2 (HMM E-Value=2.7e-17)
          Length = 539

 Score = 31.5 bits (68), Expect = 0.40
 Identities = 18/64 (28%), Positives = 34/64 (53%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V ++      P+D +G  D  VTI L+ + ++R  T++   + +P++ E F   +  T
Sbjct: 151 LTVHLICGRGFPPRDFSGSLDTCVTIALLPDRTNRKQTAIHRRSTSPLYNETFVFRI--T 208

Query: 442 VNED 453
            +ED
Sbjct: 209 ADED 212


>SB_34190| Best HMM Match : MAM (HMM E-Value=0)
          Length = 384

 Score = 31.1 bits (67), Expect = 0.53
 Identities = 16/40 (40%), Positives = 20/40 (50%)
 Frame = -1

Query: 246 SLASALVRSCVCLSLPILNASCTYDSIACCPTSQPTSHPP 127
           +LASA VR C C   P   A CT+D   C  ++  T   P
Sbjct: 150 TLASADVRRCFCRYAPPHTADCTFDENWCHWSNDNTGSSP 189


>SB_58025| Best HMM Match : C2 (HMM E-Value=0.0016)
          Length = 103

 Score = 31.1 bits (67), Expect = 0.53
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +1

Query: 331 VTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM-SGTVNEDSLCLEVWDFD 483
           V  Y+ +    +  T V  G+ NPV+ EHF   M    +   SL  EV+  D
Sbjct: 6   VLYYVQNKLVDKKKTKVAKGSTNPVFNEHFVFEMKEEELKNSSLLCEVYQSD 57


>SB_17935| Best HMM Match : C2 (HMM E-Value=6.1e-07)
          Length = 129

 Score = 30.7 bits (66), Expect = 0.70
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 2/36 (5%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHF 420
           +DPFV + LM +     +  TSV  GTL PV+ E F
Sbjct: 23  TDPFVKVSLMVSGRQIKKTKTSVMHGTLRPVYNEAF 58


>SB_16478| Best HMM Match : C2 (HMM E-Value=2.2e-13)
          Length = 186

 Score = 30.3 bits (65), Expect = 0.92
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 3/67 (4%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSH---RYNTSVKSGTLNPVWEEHFSLPM 432
           L + V +A DL P    G    +  + L+++S     R  T+VK+ TLNPV+ E  +   
Sbjct: 29  LTIVVFKARDLKPLT-EGYPAVYAEVVLVNSSRRIRKRKATTVKNSTLNPVYNEAMAFDA 87

Query: 433 SGTVNED 453
           +    ED
Sbjct: 88  ANMKLED 94


>SB_22143| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1995

 Score = 29.5 bits (63), Expect = 1.6
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +2

Query: 152 VGQHAMLSYVQEAFKIGNDKHTQLLTKAEAKEPPG 256
           +G+ AM  Y+ +  K+  DK  +   KAE K  PG
Sbjct: 474 IGEKAMTPYIDKLDKLKADKVKEFADKAEIKAKPG 508


>SB_30502| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 248

 Score = 29.1 bits (62), Expect = 2.1
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 3/54 (5%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSH--RYNTSVKSGTLNPVWEEHFSLPMSG-TVNEDSLCLEV 471
           +DP++ + L  +     + NT VK  TLNP++ E F+  ++   ++  ++ L V
Sbjct: 144 TDPYIKLSLYCDGVRLSKANTRVKRRTLNPIYNEKFNFNVTADQISHTTVALRV 197


>SB_23139| Best HMM Match : Flotillin (HMM E-Value=0.11)
          Length = 1166

 Score = 28.3 bits (60), Expect = 3.7
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = -1

Query: 186  SCTYDSIACCPTSQPTSHPPTL 121
            S  ++ + CCP  Q TSH P L
Sbjct: 1064 SMLHEDLNCCPVPQDTSHEPQL 1085


>SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2014

 Score = 27.9 bits (59), Expect = 4.9
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 4/78 (5%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDP--FVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP-- 429
            L++ V+  + +   D   L  P   V + ++    H   T   S TLNPV+ E F +P  
Sbjct: 1901 LHITVINVSGIPTSDETFLRPPNCSVKMRILPEMLHWQWTRKVSRTLNPVFNETFIVPGF 1960

Query: 430  MSGTVNEDSLCLEVWDFD 483
            +   + E +    V DFD
Sbjct: 1961 VHNKLRECTAHFVVLDFD 1978


>SB_18049| Best HMM Match : C2 (HMM E-Value=3.2)
          Length = 52

 Score = 27.9 bits (59), Expect = 4.9
 Identities = 12/34 (35%), Positives = 17/34 (50%)
 Frame = +1

Query: 331 VTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           V  Y+ +    +  T V  G+ NPV+ EHF   M
Sbjct: 6   VLYYVQNKLVDKKKTKVAKGSTNPVFNEHFVFEM 39


>SB_48082| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 665

 Score = 27.5 bits (58), Expect = 6.5
 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 4/31 (12%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKD----PNGLSDPFVTI 339
           +L +EV EA DLV KD      G SDP+  +
Sbjct: 317 VLRIEVTEAKDLVAKDIAVFKKGTSDPYAMV 347


>SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2870

 Score = 27.1 bits (57), Expect = 8.6
 Identities = 10/24 (41%), Positives = 14/24 (58%), Gaps = 1/24 (4%)
 Frame = -1

Query: 186  SCTYDS-IACCPTSQPTSHPPTLC 118
            +CT D  + CC  S P +  PT+C
Sbjct: 1806 TCTPDCPVMCCKNSSPATECPTIC 1829


>SB_15237| Best HMM Match : NHL (HMM E-Value=0)
          Length = 997

 Score = 27.1 bits (57), Expect = 8.6
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%)
 Frame = -3

Query: 490 LLDRSPTLLSKGNLHSQCQTW--VKKNVLPKQDLEFPTSPMCCTG 362
           +++ +  LL KG+    CQ    VK N+  +  LEF +SP+   G
Sbjct: 532 VIEYAENLLEKGSTLEICQLAEEVKANLQQQSSLEFVSSPLATKG 576


>SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43)
          Length = 547

 Score = 27.1 bits (57), Expect = 8.6
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = +2

Query: 125 VGGC-DVGCEVGQHAMLSYVQEAFKIGNDKHTQLLTKAEA 241
           +G C DVGC++ Q      + E  K G+D  T +L K E+
Sbjct: 436 MGKCGDVGCQITQMKRKKNMIEMGKCGDDMGTIVLGKVES 475


>SB_8486| Best HMM Match : Granulin (HMM E-Value=0)
          Length = 878

 Score = 27.1 bits (57), Expect = 8.6
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = -1

Query: 201 PILNASCTYDSIACCP 154
           P+ NASC  D + CCP
Sbjct: 848 PLPNASCCSDGLHCCP 863


>SB_7181| Best HMM Match : C2 (HMM E-Value=1.2e-15)
          Length = 630

 Score = 27.1 bits (57), Expect = 8.6
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = +1

Query: 322 DPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           DP+V I++ +  + +  T V     NP W E F
Sbjct: 353 DPYVKIHIPTAPNGKAQTKVMDDNPNPEWHETF 385


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,948,495
Number of Sequences: 59808
Number of extensions: 313143
Number of successful extensions: 926
Number of sequences better than 10.0: 47
Number of HSP's better than 10.0 without gapping: 846
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 912
length of database: 16,821,457
effective HSP length: 77
effective length of database: 12,216,241
effective search space used: 1075029208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).