SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0106
         (711 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.)               76   2e-14
SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9)                   76   3e-14
SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.)              75   8e-14
SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35)                 63   2e-10
SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   4e-09
SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   4e-09
SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   4e-09
SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   4e-09
SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   4e-09
SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   4e-09
SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.)               59   4e-09
SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   5e-09
SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.)               58   7e-09
SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   9e-09
SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.)               58   9e-09
SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               57   2e-08
SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               57   2e-08
SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               57   2e-08
SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               57   2e-08
SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.)                57   2e-08
SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)                 57   2e-08
SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               57   2e-08
SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               57   2e-08
SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               57   2e-08
SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               57   2e-08
SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8)             57   2e-08
SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   2e-08
SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.)                57   2e-08
SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   2e-08
SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6)                56   2e-08
SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   2e-08
SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8)                    56   2e-08
SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9)               56   3e-08
SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9)                   56   4e-08
SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   4e-08
SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3)                 56   4e-08
SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   4e-08
SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   4e-08
SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   5e-08
SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   5e-08
SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   7e-08
SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   9e-08
SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               54   9e-08
SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   9e-08
SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   9e-08
SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022)                  54   9e-08
SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   2e-07
SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   2e-07
SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   2e-07
SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   2e-07
SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   2e-07
SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   2e-07
SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   2e-07
SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   3e-07
SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   2e-06
SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   2e-06
SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   3e-06
SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   3e-06
SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   4e-06
SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.)               49   4e-06
SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011)                    48   6e-06
SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   8e-06
SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_33090| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   7e-04
SB_21833| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   7e-04
SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   9e-04
SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   0.001
SB_48951| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   0.001
SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_18142| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_57449| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_59162| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_58689| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_58471| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_57504| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_57309| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_57160| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_57088| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_57000| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_56985| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_56864| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_56097| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_55911| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_55353| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_54657| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_54057| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_53941| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_53667| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_53456| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_53229| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_52843| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_51637| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_51120| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_51074| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_51032| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_51007| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_50996| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_50982| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_50953| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_50936| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_50384| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_50220| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_49746| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_49667| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_49638| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_49334| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_49116| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_49113| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_49028| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_48983| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_48970| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_48539| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_48364| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_47957| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_47808| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_47385| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_47361| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_47000| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_46654| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_46429| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_46359| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_46213| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_45478| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_45234| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_44852| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_44662| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_43993| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_43758| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_43593| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_43340| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_43144| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_43093| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_42443| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_42383| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_42278| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_42126| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_41977| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_40549| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_40449| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_40443| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_40197| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_39975| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_39947| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_39754| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_39490| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_38568| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_38390| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_38374| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_38338| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_38296| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_37924| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_37621| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_37575| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_37514| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_36927| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_36111| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_35639| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_35629| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_35549| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_35413| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_35273| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_35215| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_35079| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_34965| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_34867| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_34812| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_34787| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_34475| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_34273| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_34020| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_34019| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_33900| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_33633| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_33156| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_33065| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_32699| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_32249| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_31827| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_31689| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_31560| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_31456| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_31442| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_31298| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_31283| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_31155| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_31061| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_30878| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_29626| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_29443| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_28945| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_28854| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_28678| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_28435| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_27744| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_27513| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_27344| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_26541| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_26180| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_26102| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_26045| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_25987| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_25886| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_24955| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_24149| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_24008| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_23901| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_23701| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_23491| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_23324| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_23308| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_23301| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_23277| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_22929| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_22512| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_22481| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_22451| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_21947| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_21159| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_21030| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_20944| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_20880| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_20832| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_20742| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_20690| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_20420| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_20060| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_20036| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_19743| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_19490| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_19448| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_18813| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_18603| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_18478| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_18315| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_17938| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_17616| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_17417| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_17352| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_17230| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_16690| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_16230| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_15921| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_15429| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_15370| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_14040| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_13500| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_12864| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_12842| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_12053| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_12049| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_11704| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_11587| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6)             40   0.003
SB_10981| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_10838| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_10043| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_9790| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_9789| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_9564| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_9236| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_9227| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_9169| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_8203| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_8131| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_7699| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_7316| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_7204| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_6994| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_6265| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_6232| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_6109| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_6103| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_5995| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_5987| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_5937| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_5666| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_5533| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_4915| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_4853| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_4538| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_4213| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_4133| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_3630| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_3555| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_3396| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_3272| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_3008| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_2936| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_2741| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_2242| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_1859| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_1767| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_1708| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_1630| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_1626| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_1413| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_1202| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_1184| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.003
SB_620| Best HMM Match : No HMM Matches (HMM E-Value=.)                40   0.003
SB_597| Best HMM Match : No HMM Matches (HMM E-Value=.)                40   0.003
SB_141| Best HMM Match : No HMM Matches (HMM E-Value=.)                40   0.003
SB_59761| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_59213| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_59171| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_58614| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_58352| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_58007| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_57897| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_56954| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_56879| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_56115| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_55873| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_55845| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_55688| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_54804| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_54790| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_54567| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_54499| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_54386| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003

>SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 107

 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 40/83 (48%), Positives = 48/83 (57%), Gaps = 1/83 (1%)
 Frame = -1

Query: 342 TGPHPLPVQTRHA-PVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEPARHL 166
           +GP PL        P LRANP+ EVTD    FPYLH SI+ RL TLETCCGY Y+  R  
Sbjct: 23  SGPGPLASSLSPTDPTLRANPFPEVTDLFADFPYLHCSINQRLLTLETCCGYEYDRTR-- 80

Query: 165 HVHPSPEFSRSAESIRTPPQMRC 97
               SP F   + + RTP ++ C
Sbjct: 81  KSMSSPNFQGPSRAHRTPQEVWC 103


>SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9)
          Length = 276

 Score = 75.8 bits (178), Expect = 3e-14
 Identities = 40/86 (46%), Positives = 48/86 (55%), Gaps = 1/86 (1%)
 Frame = -1

Query: 342 TGPHPLPVQTRHA-PVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEPARHL 166
           +GP PL        P LRANP+ EVTD  C  PYLH SI+ RL TLETCCGY Y+  R  
Sbjct: 127 SGPGPLASSLSPTDPTLRANPFPEVTDLFCRLPYLHCSINQRLLTLETCCGYEYDRTR-- 184

Query: 165 HVHPSPEFSRSAESIRTPPQMRCSSR 88
               SP F   + + RTP ++    R
Sbjct: 185 KSMSSPNFQGPSRAHRTPQEICTGGR 210


>SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 107

 Score = 74.5 bits (175), Expect = 8e-14
 Identities = 39/83 (46%), Positives = 47/83 (56%), Gaps = 1/83 (1%)
 Frame = -1

Query: 342 TGPHPLPVQTRHA-PVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEPARHL 166
           +GP PL        P LRANP+ EVTD  C  P LH SI+ RL TLETCCGY Y+  R  
Sbjct: 23  SGPGPLASSLSPTDPTLRANPFPEVTDLFCRLPLLHCSINQRLLTLETCCGYEYDRTR-- 80

Query: 165 HVHPSPEFSRSAESIRTPPQMRC 97
               SP F   + + RTP ++ C
Sbjct: 81  KSMSSPNFQGPSRAHRTPQEVWC 103


>SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35)
          Length = 521

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 27/35 (77%), Positives = 30/35 (85%)
 Frame = -3

Query: 688 HSEHWAEITLRQHPRGPSQCFVLIRQSDSPCPCQF 584
           ++EHWAEITLRQH   PSQCFVLI+QSDSP  CQF
Sbjct: 48  NNEHWAEITLRQHRFRPSQCFVLIKQSDSPSHCQF 82


>SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 35/87 (40%), Positives = 45/87 (51%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP+F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPDFQGSSRAHRTPQEVWC 102


>SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 35/87 (40%), Positives = 45/87 (51%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP FS ++ + RTP ++ C
Sbjct: 67  TR--KSMSSPNFSGASRAHRTPQEVWC 91


>SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 107

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 20  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 78

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 79  TR--KSMSSPNFQGSSRAHRTPQEVWC 103


>SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 107

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/89 (39%), Positives = 44/89 (49%)
 Frame = -1

Query: 363 RTSTRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGY 184
           R S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y
Sbjct: 18  RASASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEY 76

Query: 183 EPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           +  R      SP F   + + RTP ++ C
Sbjct: 77  DRTR--KSMSSPNFQGPSRAHRTPQEVWC 103


>SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/89 (39%), Positives = 44/89 (49%)
 Frame = -1

Query: 363 RTSTRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGY 184
           R S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y
Sbjct: 17  RASASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEY 75

Query: 183 EPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           +  R      SP F   + + RTP ++ C
Sbjct: 76  DRTR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 107

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/89 (39%), Positives = 44/89 (49%)
 Frame = -1

Query: 363 RTSTRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGY 184
           R S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y
Sbjct: 18  RASASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEY 76

Query: 183 EPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           +  R      SP F   + + RTP ++ C
Sbjct: 77  DRTR--KSMSSPNFQGPSRAHRTPQEVWC 103


>SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 113

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/89 (39%), Positives = 44/89 (49%)
 Frame = -1

Query: 363 RTSTRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGY 184
           R S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y
Sbjct: 24  RASASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEY 82

Query: 183 EPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           +  R      SP F   + + RTP ++ C
Sbjct: 83  DRTR--KSMSSPNFQGPSRAHRTPQEVWC 109


>SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/89 (39%), Positives = 44/89 (49%)
 Frame = -1

Query: 363 RTSTRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGY 184
           R S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y
Sbjct: 6   RASASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEY 64

Query: 183 EPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           +  R      SP F   + + RTP ++ C
Sbjct: 65  DRTR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 178

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/89 (39%), Positives = 44/89 (49%)
 Frame = -1

Query: 363 RTSTRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGY 184
           R S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y
Sbjct: 89  RASASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEY 147

Query: 183 EPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           +  R      SP F   + + RTP ++ C
Sbjct: 148 DRTR--KSMSSPNFQGPSRAHRTPQEVWC 174


>SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGSSRAHRTPQEVWC 91


>SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 107

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/89 (39%), Positives = 44/89 (49%)
 Frame = -1

Query: 363 RTSTRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGY 184
           R S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y
Sbjct: 18  RASASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEY 76

Query: 183 EPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           +  R      SP F   + + RTP ++ C
Sbjct: 77  DRTR--KSMSSPNFQGPSRAHRTPQEVWC 103


>SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/89 (39%), Positives = 44/89 (49%)
 Frame = -1

Query: 363 RTSTRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGY 184
           R S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y
Sbjct: 38  RASASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEY 96

Query: 183 EPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           +  R      SP F   + + RTP ++ C
Sbjct: 97  DRTR--KSMSSPNFQGPSRAHRTPQEVWC 123


>SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGSSRAHRTPQEVWC 91


>SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGSSRAHRTPQEVWC 91


>SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 113

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/89 (39%), Positives = 44/89 (49%)
 Frame = -1

Query: 363 RTSTRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGY 184
           R S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y
Sbjct: 24  RASASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEY 82

Query: 183 EPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           +  R      SP F   + + RTP ++ C
Sbjct: 83  DRTR--KSMSSPNFQGPSRAHRTPQEVWC 109


>SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/89 (39%), Positives = 44/89 (49%)
 Frame = -1

Query: 363 RTSTRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGY 184
           R S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y
Sbjct: 6   RASASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEY 64

Query: 183 EPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           +  R      SP F   + + RTP ++ C
Sbjct: 65  DRTR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V TR    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSTRQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGSSRAHRTPQEVWC 91


>SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 35/87 (40%), Positives = 44/87 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+ + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQEVWC 102


>SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 78

 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 32/73 (43%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = -1

Query: 312 RHAPVLRANPYSE-VTDPICHFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSR 136
           R    L ANP+S  +      FPYLH SI+ RL TLETCCGY Y+  R      SP F  
Sbjct: 4   RQTQPLEANPFSRRLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQG 61

Query: 135 SAESIRTPPQMRC 97
            + + RTP ++ C
Sbjct: 62  PSRAHRTPQEVWC 74


>SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 107

 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 32/79 (40%), Positives = 41/79 (51%)
 Frame = -1

Query: 333 HPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEPARHLHVHP 154
           H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+  R      
Sbjct: 27  HWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMS 84

Query: 153 SPEFSRSAESIRTPPQMRC 97
           SP F  S+ + RTP ++ C
Sbjct: 85  SPNFQGSSRAHRTPQEVWC 103


>SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 107

 Score = 57.6 bits (133), Expect = 9e-09
 Identities = 34/86 (39%), Positives = 43/86 (50%), Gaps = 1/86 (1%)
 Frame = -1

Query: 351 RPGTGP-HPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEPA 175
           RP  G  H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+  
Sbjct: 20  RPAPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRT 79

Query: 174 RHLHVHPSPEFSRSAESIRTPPQMRC 97
           R      SP F   + + RTP ++ C
Sbjct: 80  R--KSMSSPNFQGPSRAHRTPQEVWC 103


>SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 57.6 bits (133), Expect = 9e-09
 Identities = 35/87 (40%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 58  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 116

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F  S+   RTP ++ C
Sbjct: 117 TR--KSMSSPNFQGSSRVHRTPQEVWC 141


>SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 57  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 115

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 116 TR--KSMSSPNFQGPSRAHRTPQEVWC 140


>SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 179

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 92  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 150

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 151 TR--KSMSSPNFQGPSRAHRTPQEVWC 175


>SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 179

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 92  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 150

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 151 TR--KSMSSPNFQGPSRAHRTPQEVWC 175


>SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 179

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 92  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 150

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 151 TR--KSMSSPNFQGPSRAHRTPQEVWC 175


>SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 107

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 20  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 78

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 79  TR--KSMSSPNFQGPSRAHRTPQEVWC 103


>SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 107

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 20  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 78

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 79  TR--KSMSSPNFQGPSRAHRTPQEVWC 103


>SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 248

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 161 SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 219

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 220 TR--KSMSSPNFQGPSRAHRTPQEVWC 244


>SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 116

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 29  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 87

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 88  TR--KSMSSPNFQGPSRAHRTPQEVWC 112


>SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 57  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 115

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 116 TR--KSMSSPNFQGPSRAHRTPQEVWC 140


>SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 218

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 131 SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 189

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 190 TR--KSMSSPNFQGPSRAHRTPQEVWC 214


>SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 179

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 92  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 150

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 151 TR--KSMSSPNFQGPSRAHRTPQEVWC 175


>SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 179

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 92  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 150

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 151 TR--KSMSSPNFQGPSRAHRTPQEVWC 175


>SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 217

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 130 SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 188

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 189 TR--KSMSSPNFQGPSRAHRTPQEVWC 213


>SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 217

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 130 SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 188

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 189 TR--KSMSSPNFQGPSRAHRTPQEVWC 213


>SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8)
          Length = 204

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 117 SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 175

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 176 TR--KSMSSPNFQGPSRAHRTPQEVWC 200


>SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 57  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 115

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 116 TR--KSMSSPNFQGPSRAHRTPQEVWC 140


>SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 58  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 116

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 117 TR--KSMSSPNFQGPSRAHRTPQEVWC 141


>SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 57  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 115

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 116 TR--KSMSSPNFQGPSRAHRTPQEVWC 140


>SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 8   SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 66

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 67  TR--KSMSSPNFQGPSRAHRTPQEVWC 91


>SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R         +S++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARRTQSKEPILFSKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6)
          Length = 106

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLHTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFVDFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8)
          Length = 411

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 35/89 (39%), Positives = 44/89 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 171 SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 229

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRCSS 91
            R      SP F  S+ + RTP +   S+
Sbjct: 230 TR--KSMSSPNFQGSSRAHRTPQEALTSA 256


>SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 34/87 (39%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 57  SASPGR-VHWLQVLARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 115

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 116 TR--KSMSSPNFQGPSRAHRTPQEVWC 140


>SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 31/79 (39%), Positives = 40/79 (50%)
 Frame = -1

Query: 333 HPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEPARHLHVHP 154
           H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+  R      
Sbjct: 26  HWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMS 83

Query: 153 SPEFSRSAESIRTPPQMRC 97
           SP F   + + RTP ++ C
Sbjct: 84  SPNFQGPSRAHRTPQEVWC 102


>SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 101

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 31/79 (39%), Positives = 40/79 (50%)
 Frame = -1

Query: 333 HPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEPARHLHVHP 154
           H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+  R      
Sbjct: 21  HWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMS 78

Query: 153 SPEFSRSAESIRTPPQMRC 97
           SP F   + + RTP ++ C
Sbjct: 79  SPNFQGPSRAHRTPQEVWC 97


>SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9)
          Length = 227

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 34/84 (40%), Positives = 42/84 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQ 106
            R      SP F  S+ + RTP +
Sbjct: 78  TR--KSMSSPNFQGSSRAHRTPQE 99


>SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 31/79 (39%), Positives = 40/79 (50%)
 Frame = -1

Query: 333 HPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEPARHLHVHP 154
           H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+  R      
Sbjct: 26  HWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMS 83

Query: 153 SPEFSRSAESIRTPPQMRC 97
           SP F   + + RTP ++ C
Sbjct: 84  SPNFQGPSRAHRTPQEVWC 102


>SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 31/79 (39%), Positives = 40/79 (50%)
 Frame = -1

Query: 333 HPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEPARHLHVHP 154
           H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+  R      
Sbjct: 15  HWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMS 72

Query: 153 SPEFSRSAESIRTPPQMRC 97
           SP F   + + RTP ++ C
Sbjct: 73  SPNFQGPSRAHRTPQEVWC 91


>SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 34/87 (39%), Positives = 42/87 (48%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y  
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYNR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9)
          Length = 321

 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 32/83 (38%), Positives = 42/83 (50%), Gaps = 1/83 (1%)
 Frame = -1

Query: 342 TGPHPLPVQTRHA-PVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEPARHL 166
           +GP PL        P L    + ++      FPYLH SI+ RL TLETCCGY Y+  R  
Sbjct: 237 SGPGPLASSLSPTDPTLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR-- 294

Query: 165 HVHPSPEFSRSAESIRTPPQMRC 97
               SP F   + + RTP ++ C
Sbjct: 295 KSMSSPNFQGPSRAHRTPQEVWC 317


>SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 100

 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 34/82 (41%), Positives = 41/82 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    +S++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARRTQSLEPILFSKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTP 112
            R      SP F   + + RTP
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTP 97


>SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3)
          Length = 237

 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 36/94 (38%), Positives = 45/94 (47%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRCSSRSEPY 76
            R      SP F   + + RTP +   + R  PY
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQE---TGRMRPY 106



 Score = 29.5 bits (63), Expect = 2.8
 Identities = 25/73 (34%), Positives = 32/73 (43%), Gaps = 1/73 (1%)
 Frame = -2

Query: 293 EPILIPKLRIQFATSLTYIILS-TRGSSPWRPAADMGTNRRDISTYIPHLNFQGPQRVSG 117
           EPIL PKLRI FA    Y+  S  +             +R   S   P  NFQGP R   
Sbjct: 39  EPILFPKLRIYFA-DFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSP--NFQGPSRAHR 95

Query: 116 HRRKCGALRVPNH 78
             ++ G +R  +H
Sbjct: 96  TPQETGRMRPYDH 108


>SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 27/52 (51%), Positives = 33/52 (63%)
 Frame = -1

Query: 252 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           FPYLH SI+ RL TLETCCGY Y+  R      SP F  S+ + RTP ++ C
Sbjct: 105 FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 154


>SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 33/87 (37%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH +I+ RL TLETCCGY Y+ 
Sbjct: 32  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCAINQRLLTLETCCGYEYDR 90

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 91  TR--KSMSSPNFQGPSRAHRTPQEVWC 115


>SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 211

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 34/86 (39%), Positives = 42/86 (48%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 57  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 115

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMR 100
            R      SP F   + + RTP + R
Sbjct: 116 TR--KSMSSPNFQGPSRAHRTPQENR 139


>SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 33/87 (37%), Positives = 42/87 (48%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R         + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPFEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVCC 102


>SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 33/87 (37%), Positives = 43/87 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R     P+  F   + + RTP ++ C
Sbjct: 78  TRKSMSFPN--FQGPSRAHRTPQEVWC 102


>SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 106

 Score = 54.4 bits (125), Expect = 9e-08
 Identities = 33/87 (37%), Positives = 42/87 (48%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL  LETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLKLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F   + + RTP ++ C
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEVWC 102


>SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 402

 Score = 54.4 bits (125), Expect = 9e-08
 Identities = 34/89 (38%), Positives = 43/89 (48%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 158 SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 216

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRCSS 91
            R      SP F   + + RTP +   S+
Sbjct: 217 TR--KSMSSPNFQGPSRAHRTPQEALTSA 243


>SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 112

 Score = 54.4 bits (125), Expect = 9e-08
 Identities = 32/81 (39%), Positives = 40/81 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRT 115
            R     P+ EF +   S R+
Sbjct: 78  TRKSMSSPNIEFLQPGGSTRS 98


>SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 54.4 bits (125), Expect = 9e-08
 Identities = 34/78 (43%), Positives = 39/78 (50%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAES 124
            R       PEFSR  ES
Sbjct: 78  TR--KSMSFPEFSRVVES 93


>SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022)
          Length = 309

 Score = 54.4 bits (125), Expect = 9e-08
 Identities = 33/85 (38%), Positives = 42/85 (49%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQM 103
            R      SP F   + + RTP ++
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQEV 100


>SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 33/84 (39%), Positives = 41/84 (48%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQ 106
            R      SP F   + + RTP +
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQE 99


>SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 26/52 (50%), Positives = 32/52 (61%)
 Frame = -1

Query: 252 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           FPYLH SI+ RL TLETCCGY Y+  R      SP F   + + RTP ++ C
Sbjct: 9   FPYLHVSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 58


>SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 261

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 33/84 (39%), Positives = 41/84 (48%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQ 106
            R      SP F   + + RTP +
Sbjct: 78  TR--KSMSSPNFQGPSRAHRTPQE 99


>SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 61

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 26/52 (50%), Positives = 32/52 (61%)
 Frame = -1

Query: 252 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           FPYLH SI+ RL TLETCCGY Y+  R      SP F   + + RTP ++ C
Sbjct: 8   FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 57


>SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 61

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 26/52 (50%), Positives = 32/52 (61%)
 Frame = -1

Query: 252 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           FPYLH SI+ RL TLETCCGY Y+  R      SP F   + + RTP ++ C
Sbjct: 8   FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 57


>SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 68

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 26/52 (50%), Positives = 32/52 (61%)
 Frame = -1

Query: 252 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           FPYLH SI+ RL TLETCCGY Y+  R      SP F   + + RTP ++ C
Sbjct: 15  FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 64


>SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 26/52 (50%), Positives = 32/52 (61%)
 Frame = -1

Query: 252 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           FPYLH SI+ RL TLETCCGY Y+  R      SP F   + + RTP ++ C
Sbjct: 9   FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 58


>SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 61

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 26/52 (50%), Positives = 32/52 (61%)
 Frame = -1

Query: 252 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           FPYLH SI+ RL TLETCCGY Y+  R      SP F   + + RTP ++ C
Sbjct: 8   FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 57


>SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 172

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 30/77 (38%), Positives = 39/77 (50%)
 Frame = -1

Query: 333 HPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEPARHLHVHP 154
           H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+  R      
Sbjct: 15  HWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMS 72

Query: 153 SPEFSRSAESIRTPPQM 103
           SP F   + + RTP ++
Sbjct: 73  SPNFQGPSRAHRTPQEV 89


>SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 105

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 26/52 (50%), Positives = 32/52 (61%)
 Frame = -1

Query: 252 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           FPYLH SI+ RL TLETCCGY Y+  R      SP F   + + RTP ++ C
Sbjct: 52  FPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 101


>SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 31/78 (39%), Positives = 38/78 (48%)
 Frame = -1

Query: 333 HPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEPARHLHVHP 154
           H L V  R    L      ++      FPYLH SI+ RL TLETCCGY Y+  R      
Sbjct: 15  HWLQVSARQTQPLEPILLPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMS 72

Query: 153 SPEFSRSAESIRTPPQMR 100
           SP F   + + RTP + R
Sbjct: 73  SPNFQGPSRAHRTPQEDR 90


>SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 101

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 34/87 (39%), Positives = 40/87 (45%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRTPPQMRC 97
            R      SP F    E  RT    +C
Sbjct: 78  TR--KSMSSPNFQGRRE--RTGHHKKC 100


>SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 100

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 31/81 (38%), Positives = 38/81 (46%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 ARHLHVHPSPEFSRSAESIRT 115
            R      SP F    ++  T
Sbjct: 78  TR--KSMSSPNFQGRQDATET 96


>SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 88

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 27/62 (43%), Positives = 32/62 (51%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 AR 172
            R
Sbjct: 78  TR 79


>SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 27/62 (43%), Positives = 32/62 (51%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 AR 172
            R
Sbjct: 78  TR 79


>SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 72

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 24/43 (55%), Positives = 27/43 (62%)
 Frame = -1

Query: 252 FPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 124
           FPYLH SI+ RL TLETCCGY Y+  R      SP F  + ES
Sbjct: 8   FPYLHVSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGAVES 48


>SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 82

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 27/62 (43%), Positives = 33/62 (53%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V +R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 19  SASPGR-VHWLQVSSRQTQSLDPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 77

Query: 177 AR 172
            R
Sbjct: 78  TR 79


>SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011)
          Length = 782

 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 27/62 (43%), Positives = 32/62 (51%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEP 178
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+ 
Sbjct: 714 SASPGR-VHWLQVLARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDR 772

Query: 177 AR 172
            R
Sbjct: 773 TR 774


>SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 113

 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 26/59 (44%), Positives = 31/59 (52%)
 Frame = -1

Query: 357 STRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYE 181
           S  PG   H L V  R    L    + ++      FPYLH SI+ RL TLETCCGY Y+
Sbjct: 19  SASPGR-VHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76


>SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 34/92 (36%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = -3

Query: 328 ASRPNPTRPGPQSQSLFRSYGSNLPLPLPTLFYRLEALHLGDLLRIWVRTGATSPRTSLT 149
           AS  +PT P  ++            LPLPTLFY+ EA HLGDLLR+ VR     P T + 
Sbjct: 69  ASSLSPTDPTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLRLLVR-----PDTKIN 123

Query: 148 *IFKVRR---EYPDTAANAVLFAFRTISPFYR 62
              +  R     PDT  + V+  +R ++P  R
Sbjct: 124 VFPEFSRAVESAPDTTRSVVV--YRALNPISR 153


>SB_33090| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 83

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 20/42 (47%), Positives = 25/42 (59%)
 Frame = -1

Query: 222 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           RL TLETCCGY Y+  R      SP F  S+ + RTP ++ C
Sbjct: 40  RLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 79


>SB_21833| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 83

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 20/42 (47%), Positives = 25/42 (59%)
 Frame = -1

Query: 222 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           RL TLETCCGY Y+  R      SP F  S+ + RTP ++ C
Sbjct: 40  RLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 79


>SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 56

 Score = 41.1 bits (92), Expect = 9e-04
 Identities = 24/53 (45%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = -1

Query: 222 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSS--RSEPYLP 70
           RL TLETCCGY Y+  R       PEFSR+    RT    +C +    +PYLP
Sbjct: 1   RLLTLETCCGYEYDRTR--KSMSFPEFSRAVRE-RTGHHKKCGALPSIKPYLP 50


>SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 51

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 21/50 (42%), Positives = 27/50 (54%)
 Frame = -1

Query: 222 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRSEPYL 73
           RL TLETCCGY Y+  R      SP+F   + + RTP +       +PYL
Sbjct: 1   RLLTLETCCGYEYDRTR--KSMSSPKFQGPSRAHRTPQKCGALPSIKPYL 48


>SB_48951| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 38

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/33 (60%), Positives = 22/33 (66%)
 Frame = -1

Query: 222 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 124
           RL TLETCCGY Y+  R      SPEFSR+ ES
Sbjct: 1   RLLTLETCCGYEYDRTR--KSMSSPEFSRAVES 31


>SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 55

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 20/46 (43%), Positives = 26/46 (56%)
 Frame = -1

Query: 222 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRS 85
           RL TLETCCGY Y+  R      SP F   + + RTP ++ C  R+
Sbjct: 1   RLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWCFYRA 44


>SB_18142| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 44

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 22/42 (52%), Positives = 26/42 (61%)
 Frame = -1

Query: 222 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           RLFTLETCCGY Y   R     PS +F  S+E+ RT  +M C
Sbjct: 1   RLFTLETCCGYEYGWVRE-SFSPS-DFHGSSEAHRTQQKMSC 40


>SB_57449| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 44

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 19/42 (45%), Positives = 25/42 (59%)
 Frame = -1

Query: 222 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           RL TLETCCGY Y+  R      SP F  ++ + RTP ++ C
Sbjct: 1   RLLTLETCCGYEYDRTR--KSMSSPNFQGASRAHRTPQEVWC 40


>SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 55

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 20/51 (39%), Positives = 26/51 (50%)
 Frame = -1

Query: 222 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRSEPYLP 70
           RL TLETCCGY Y+  R      SP F   + + RTP ++ C +      P
Sbjct: 1   RLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWCFTEHSTLSP 49


>SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 44

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 19/42 (45%), Positives = 24/42 (57%)
 Frame = -1

Query: 222 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 97
           RL TLETCCGY Y+  R      SP F   + + RTP ++ C
Sbjct: 1   RLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 40


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,943,298
Number of Sequences: 59808
Number of extensions: 588622
Number of successful extensions: 3695
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 2514
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2732
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1877743452
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).