SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0103
         (685 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5)                      77   1e-14
SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37)         77   1e-14
SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13)            77   1e-14
SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.)               77   1e-14
SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.)                 77   1e-14
SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15)              77   1e-14
SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8)                   77   1e-14
SB_21148| Best HMM Match : PAN (HMM E-Value=0.49)                      77   1e-14
SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031)                 77   1e-14
SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   1e-14
SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.)               77   1e-14
SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.)               77   1e-14
SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.)               77   1e-14
SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.)               77   1e-14
SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35)                 63   2e-10
SB_13397| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   2e-06
SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2)            49   3e-06
SB_7317| Best HMM Match : No HMM Matches (HMM E-Value=.)               49   3e-06
SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   4e-06
SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   4e-06
SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   7e-06
SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   9e-06
SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5)                     47   2e-05
SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.)               47   2e-05
SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017)           46   2e-05
SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7)            46   3e-05
SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1)           46   3e-05
SB_15771| Best HMM Match : VQ (HMM E-Value=4.3)                        46   3e-05
SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0)                    46   3e-05
SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   4e-05
SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69)           45   5e-05
SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   5e-05
SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   5e-05
SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   5e-05
SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4)                     45   5e-05
SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)                     45   5e-05
SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058)              45   7e-05
SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16)                    44   9e-05
SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8)            44   9e-05
SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16)                   44   9e-05
SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3)                    44   9e-05
SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5)               44   9e-05
SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87)                   44   9e-05
SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_39984| Best HMM Match : RadC (HMM E-Value=2.2)                      44   9e-05
SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19)                   44   9e-05
SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7)                      44   9e-05
SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73)                  44   9e-05
SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30)                 44   9e-05
SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_30841| Best HMM Match : HLH (HMM E-Value=1.5)                       44   9e-05
SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2)                   44   9e-05
SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15)                     44   9e-05
SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6)                    44   9e-05
SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3)                   44   9e-05
SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21)            44   9e-05
SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3)                   44   9e-05
SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1)                      44   9e-05
SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11)              44   9e-05
SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05)                  44   9e-05
SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2)              44   9e-05
SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6)              44   9e-05
SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8)                  44   9e-05
SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3)                  44   9e-05
SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4)                     44   9e-05
SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6)                    44   9e-05
SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3)             44   9e-05
SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6)                   44   9e-05
SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6)                    44   9e-05
SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08)              44   9e-05
SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088)             44   9e-05
SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7)            44   9e-05
SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_39336| Best HMM Match : Kinesin (HMM E-Value=0)                     44   9e-05
SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8)            44   9e-05
SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7)                      44   9e-05
SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4)                44   9e-05
SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043)               44   9e-05
SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6)                    44   9e-05
SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024)                  44   9e-05
SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12)                 44   9e-05
SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05)                   44   9e-05
SB_27070| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4)            44   9e-05
SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_20517| Best HMM Match : Nuclease_act (HMM E-Value=1.4)              44   9e-05
SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1)                    44   9e-05
SB_18568| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.5e-22)         44   9e-05
SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082)                 44   9e-05
SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4)                      44   9e-05
SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6)                  44   9e-05
SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1)            44   9e-05
SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031)                  44   9e-05
SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05)             44   9e-05
SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_8821| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_8316| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_6860| Best HMM Match : zf-C3HC4 (HMM E-Value=0.14)                  44   9e-05
SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0)                  44   9e-05
SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88)                   44   9e-05
SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8)              44   9e-05
SB_4559| Best HMM Match : ICAM_N (HMM E-Value=5.3)                     44   9e-05
SB_3948| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.)                44   9e-05
SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7)                    44   1e-04
SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_6296| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   1e-04
SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   2e-04
SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039)               43   3e-04
SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7)                    43   3e-04
SB_37138| Best HMM Match : RnaseA (HMM E-Value=8)                      43   3e-04
SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39)                  43   3e-04
SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12)                   42   4e-04
SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   4e-04
SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_32717| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4)            42   4e-04
SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2)               42   5e-04
SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   5e-04
SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75)               42   5e-04
SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4)                   42   5e-04
SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   5e-04
SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31)                   42   5e-04
SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2)                       42   6e-04
SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069)                   42   6e-04
SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53)           42   6e-04
SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17)               42   6e-04
SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9)              42   6e-04
SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14)         42   6e-04
SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12)                42   6e-04
SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7)                   42   6e-04
SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3)            42   6e-04
SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2)                    42   6e-04
SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2)            42   6e-04
SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001)           42   6e-04
SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98)                42   6e-04
SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036)                    42   6e-04
SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21)                   42   6e-04
SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8)                     42   6e-04
SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   6e-04
SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   6e-04
SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   6e-04
SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8)                     42   6e-04
SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4)             42   6e-04
SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   6e-04
SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27)                     42   6e-04
SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_46352| Best HMM Match : L71 (HMM E-Value=0.19)                      42   6e-04
SB_45253| Best HMM Match : ig (HMM E-Value=0.00016)                    42   6e-04
SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_39283| Best HMM Match : ADK (HMM E-Value=3.7)                       42   6e-04
SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10)                  42   6e-04
SB_29112| Best HMM Match : Mucin (HMM E-Value=1.7)                     42   6e-04
SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34)                   42   6e-04
SB_26142| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_18550| Best HMM Match : DUF987 (HMM E-Value=4.4)                    42   6e-04
SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002)                  42   6e-04
SB_16872| Best HMM Match : ARM_1 (HMM E-Value=0)                       42   6e-04
SB_9530| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   6e-04
SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022)                     42   6e-04
SB_6524| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   6e-04
SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   6e-04
SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   6e-04
SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   6e-04
SB_3169| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   6e-04
SB_1434| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   6e-04
SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   8e-04
SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   8e-04
SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   8e-04
SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09)                 41   8e-04
SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   8e-04
SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   8e-04
SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07)                   41   8e-04
SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5)                    41   8e-04
SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   8e-04
SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15)           41   8e-04
SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012)              41   8e-04
SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06)          41   8e-04
SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   8e-04
SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2)                      41   8e-04
SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   8e-04
SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34)               41   8e-04
SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.)               41   8e-04
SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.)               41   8e-04
SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78)               41   8e-04
SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   8e-04
SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   8e-04
SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   8e-04
SB_36434| Best HMM Match : Ins_allergen_rp (HMM E-Value=5.7)           41   8e-04
SB_33876| Best HMM Match : EGF (HMM E-Value=2.4e-08)                   41   8e-04
SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   8e-04
SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.)               41   8e-04
SB_6133| Best HMM Match : ABC_tran (HMM E-Value=9e-09)                 41   8e-04
SB_870| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-09)                   41   8e-04
SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2)                    41   0.001
SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0)             40   0.001
SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.001
SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.001
SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.)                40   0.001
SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18)                       40   0.001
SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.001
SB_864| Best HMM Match : Sulfotransfer_1 (HMM E-Value=6.4e-05)         40   0.001
SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20)                    40   0.002
SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08)                   40   0.002
SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5)                    40   0.002
SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22)                 40   0.002
SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5)                    40   0.002
SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35)                   40   0.002
SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_30119| Best HMM Match : VWC (HMM E-Value=2.1)                       40   0.002
SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_16892| Best HMM Match : TIL (HMM E-Value=4.4)                       40   0.002
SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.002
SB_8444| Best HMM Match : BRE (HMM E-Value=6.4)                        40   0.002
SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.002
SB_8298| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.002
SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.002
SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34)                    40   0.002
SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1)                     40   0.002
SB_2218| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.002
SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.)                40   0.002
SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_57715| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_55419| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003)        40   0.002
SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_54385| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_51677| Best HMM Match : DUF327 (HMM E-Value=0.89)                   40   0.002
SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_50879| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_50740| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_50212| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_49154| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_46319| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15)                 40   0.002
SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_45133| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_44633| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_42693| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_41303| Best HMM Match : DUF485 (HMM E-Value=2)                      40   0.002
SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_40779| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5)            40   0.002
SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002

>SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5)
          Length = 346

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 436

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 733

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37)
          Length = 1652

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13)
          Length = 348

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 197

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 917

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 400

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15)
          Length = 846

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 818

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 573

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8)
          Length = 996

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_21148| Best HMM Match : PAN (HMM E-Value=0.49)
          Length = 183

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1653

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031)
          Length = 336

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 35/35 (100%), Positives = 35/35 (100%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE
Sbjct: 1   MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 35


>SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35)
          Length = 521

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 27/35 (77%), Positives = 30/35 (85%)
 Frame = -2

Query: 399 HSEHWAEITLRQHPRGPSQCFVLIRQSDSPCPCQF 295
           ++EHWAEITLRQH   PSQCFVLI+QSDSP  CQF
Sbjct: 48  NNEHWAEITLRQHRFRPSQCFVLIKQSDSPSHCQF 82


>SB_13397| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 513

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 19/20 (95%), Positives = 20/20 (100%)
 Frame = -2

Query: 651 WHDRFPDWKAGSERNAINVS 592
           WHDRFPDWKAGSERNAINV+
Sbjct: 190 WHDRFPDWKAGSERNAINVA 209


>SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2)
          Length = 300

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 29/60 (48%), Positives = 34/60 (56%), Gaps = 3/60 (5%)
 Frame = +1

Query: 514 LSAHNSTQHTSRKHKV*SLGCLMSE---LTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           +S   + QH S KHK  + GC   E     +   +  T    VGKPVVPAALMNRPTRGE
Sbjct: 155 ISGEYAVQH-SCKHKAFTEGCKEPEGPKHRYFRRICCTTLLQVGKPVVPAALMNRPTRGE 213


>SB_7317| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 89

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 22/25 (88%), Positives = 23/25 (92%)
 Frame = +3

Query: 510 IVIRSQFHTTYEPEA*SVKPGVPNE 584
           IVIRS FHTTY+PEA SVKPGVPNE
Sbjct: 65  IVIRSVFHTTYDPEAESVKPGVPNE 89


>SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 25/39 (64%), Positives = 29/39 (74%)
 Frame = +1

Query: 568 LGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           L C+ S++  I+ V L    PVGKPVVPAALMNRPTRGE
Sbjct: 22  LNCVPSKIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 59


>SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 452

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 21/27 (77%), Positives = 23/27 (85%)
 Frame = +1

Query: 604 CVALTARFPVGKPVVPAALMNRPTRGE 684
           C++ T  F VGKPVVPAALMNRPTRGE
Sbjct: 129 CISFTRIFRVGKPVVPAALMNRPTRGE 155


>SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 238

 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 29/51 (56%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +1

Query: 535 QHTSRKHKV*S-LGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           +H +RK K+ S L   M ++  I+ V L    PVGKPVVPAALMNRPTRGE
Sbjct: 102 EHKTRKTKLLSTLPPRMRKIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 151


>SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 20/31 (64%), Positives = 25/31 (80%)
 Frame = +1

Query: 592 THINCVALTARFPVGKPVVPAALMNRPTRGE 684
           T  +C+ ++  + VGKPVVPAALMNRPTRGE
Sbjct: 27  TGFHCILVSFGYSVGKPVVPAALMNRPTRGE 57


>SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5)
          Length = 167

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 21/24 (87%), Positives = 22/24 (91%)
 Frame = +3

Query: 387 SALNVNVKKFKQARVNGGSNYDSL 458
           +ALNV VKKF QARVNGGSNYDSL
Sbjct: 28  AALNVKVKKFNQARVNGGSNYDSL 51


>SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 24/37 (64%), Positives = 27/37 (72%)
 Frame = +1

Query: 574 CLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           C+ S +  I+ V L    PVGKPVVPAALMNRPTRGE
Sbjct: 19  CMKSVIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 54


>SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017)
          Length = 453

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/36 (63%), Positives = 26/36 (72%)
 Frame = +1

Query: 577 LMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           +M +   +  VA  AR  VGKPVVPAALMNRPTRGE
Sbjct: 208 IMKKSGSVQIVAELAREYVGKPVVPAALMNRPTRGE 243


>SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7)
          Length = 284

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 19/25 (76%), Positives = 21/25 (84%)
 Frame = +1

Query: 610 ALTARFPVGKPVVPAALMNRPTRGE 684
           A+    P+GKPVVPAALMNRPTRGE
Sbjct: 173 AINTTLPIGKPVVPAALMNRPTRGE 197


>SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1)
          Length = 753

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 19/21 (90%), Positives = 20/21 (95%)
 Frame = +1

Query: 622 RFPVGKPVVPAALMNRPTRGE 684
           R P+GKPVVPAALMNRPTRGE
Sbjct: 212 RIPIGKPVVPAALMNRPTRGE 232


>SB_15771| Best HMM Match : VQ (HMM E-Value=4.3)
          Length = 145

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 25/48 (52%), Positives = 30/48 (62%)
 Frame = +1

Query: 541 TSRKHKV*SLGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           TSR+     L  L++    ++    T R  VGKPVVPAALMNRPTRGE
Sbjct: 11  TSREFADMQLNPLVAHTILVHARTKTERTLVGKPVVPAALMNRPTRGE 58


>SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0)
          Length = 900

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 21/38 (55%), Positives = 26/38 (68%)
 Frame = +1

Query: 571 GCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           G L   +  +  + +T +  VGKPVVPAALMNRPTRGE
Sbjct: 826 GALPEVIESLPRIKITTQHTVGKPVVPAALMNRPTRGE 863


>SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 27/56 (48%), Positives = 31/56 (55%), Gaps = 2/56 (3%)
 Frame = +1

Query: 523 HNSTQHTSRKHKV*SLGCLMSELTHINCVALT--ARFPVGKPVVPAALMNRPTRGE 684
           +N T+H  R   V S+       T I  +        PVGKPVVPAALMNRPTRGE
Sbjct: 4   YNCTRHIERNAAVSSIDNAKKIDTSIKLIDTVDLEGGPVGKPVVPAALMNRPTRGE 59


>SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69)
          Length = 178

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 21/34 (61%), Positives = 25/34 (73%), Gaps = 5/34 (14%)
 Frame = +1

Query: 598 INCVALTARF-----PVGKPVVPAALMNRPTRGE 684
           + C+A   R+     P+GKPVVPAALMNRPTRGE
Sbjct: 58  VRCIAEGGRYKKNVSPIGKPVVPAALMNRPTRGE 91


>SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 182

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 25/38 (65%), Positives = 27/38 (71%)
 Frame = +1

Query: 571 GCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           G L  E+  I+ V L    PVGKPVVPAALMNRPTRGE
Sbjct: 59  GKLHIEIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 95


>SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 161

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 24/40 (60%), Positives = 28/40 (70%)
 Frame = +1

Query: 565 SLGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           S+ C  + +  I+ V L    PVGKPVVPAALMNRPTRGE
Sbjct: 36  SIDCETAIIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 74


>SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 18/20 (90%), Positives = 20/20 (100%)
 Frame = +1

Query: 625 FPVGKPVVPAALMNRPTRGE 684
           +P+GKPVVPAALMNRPTRGE
Sbjct: 71  YPIGKPVVPAALMNRPTRGE 90


>SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4)
          Length = 224

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 20/22 (90%), Positives = 20/22 (90%)
 Frame = +1

Query: 619 ARFPVGKPVVPAALMNRPTRGE 684
           A F VGKPVVPAALMNRPTRGE
Sbjct: 106 AEFSVGKPVVPAALMNRPTRGE 127


>SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)
          Length = 237

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 28/64 (43%), Positives = 34/64 (53%)
 Frame = +1

Query: 493 SCXXXXLLSAHNSTQHTSRKHKV*SLGCLMSELTHINCVALTARFPVGKPVVPAALMNRP 672
           +C      +  +ST    R     S G    ++  I+ V L    PVGKPVVPAALMNRP
Sbjct: 88  NCNTTHYRANRSSTSGGGRSRTSGSPGLQEFDIKLIDTVDLEGG-PVGKPVVPAALMNRP 146

Query: 673 TRGE 684
           TRGE
Sbjct: 147 TRGE 150


>SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058)
          Length = 168

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 24/36 (66%), Positives = 27/36 (75%)
 Frame = +1

Query: 577 LMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           L+S +  I+ V L    PVGKPVVPAALMNRPTRGE
Sbjct: 97  LLSLIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 131


>SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 191

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 23/35 (65%), Positives = 27/35 (77%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           +S++  I+ V L    PVGKPVVPAALMNRPTRGE
Sbjct: 71  VSDIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 104


>SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 231

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 23/35 (65%), Positives = 27/35 (77%)
 Frame = +1

Query: 580 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           +S++  I+ V L    PVGKPVVPAALMNRPTRGE
Sbjct: 111 ISQIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGE 144


>SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 207

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 20/31 (64%), Positives = 22/31 (70%)
 Frame = +1

Query: 592 THINCVALTARFPVGKPVVPAALMNRPTRGE 684
           T + C     R  +GKPVVPAALMNRPTRGE
Sbjct: 90  TCLRCSRFHQRLKLGKPVVPAALMNRPTRGE 120


>SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16)
          Length = 217

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 112 PVGKPVVPAALMNRPTRGE 130


>SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 37  PVGKPVVPAALMNRPTRGE 55


>SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 189

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 134 PVGKPVVPAALMNRPTRGE 152


>SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8)
          Length = 341

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 236 PVGKPVVPAALMNRPTRGE 254


>SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 56  PVGKPVVPAALMNRPTRGE 74


>SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 166

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 61  PVGKPVVPAALMNRPTRGE 79


>SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16)
          Length = 187

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 132 PVGKPVVPAALMNRPTRGE 150


>SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 105

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 50  PVGKPVVPAALMNRPTRGE 68


>SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 201

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 146 PVGKPVVPAALMNRPTRGE 164


>SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3)
          Length = 148

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 43  PVGKPVVPAALMNRPTRGE 61


>SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 33  PVGKPVVPAALMNRPTRGE 51


>SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 833

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 333 PVGKPVVPAALMNRPTRGE 351


>SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 88  PVGKPVVPAALMNRPTRGE 106


>SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 179

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 74  PVGKPVVPAALMNRPTRGE 92


>SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5)
          Length = 491

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 307 PVGKPVVPAALMNRPTRGE 325


>SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 213

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 108 PVGKPVVPAALMNRPTRGE 126


>SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 139

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 34  PVGKPVVPAALMNRPTRGE 52


>SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 806

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 468 PVGKPVVPAALMNRPTRGE 486


>SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 83

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 28  PVGKPVVPAALMNRPTRGE 46


>SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 198

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 93  PVGKPVVPAALMNRPTRGE 111


>SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 53  PVGKPVVPAALMNRPTRGE 71


>SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87)
          Length = 209

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 154 PVGKPVVPAALMNRPTRGE 172


>SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 53  PVGKPVVPAALMNRPTRGE 71


>SB_39984| Best HMM Match : RadC (HMM E-Value=2.2)
          Length = 229

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 37  PVGKPVVPAALMNRPTRGE 55


>SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19)
          Length = 216

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 161 PVGKPVVPAALMNRPTRGE 179


>SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 57  PVGKPVVPAALMNRPTRGE 75


>SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7)
          Length = 184

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 79  PVGKPVVPAALMNRPTRGE 97


>SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73)
          Length = 150

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 21/38 (55%), Positives = 24/38 (63%)
 Frame = +1

Query: 571 GCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGE 684
           G LM  ++   C+        GKPVVPAALMNRPTRGE
Sbjct: 26  GVLMFVISFSGCLGALRENVFGKPVVPAALMNRPTRGE 63


>SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 17  PVGKPVVPAALMNRPTRGE 35


>SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 56  PVGKPVVPAALMNRPTRGE 74


>SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 39  PVGKPVVPAALMNRPTRGE 57


>SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30)
          Length = 841

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 290 PVGKPVVPAALMNRPTRGE 308


>SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 334

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 37  PVGKPVVPAALMNRPTRGE 55


>SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 183

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 78  PVGKPVVPAALMNRPTRGE 96


>SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 24  PVGKPVVPAALMNRPTRGE 42


>SB_30841| Best HMM Match : HLH (HMM E-Value=1.5)
          Length = 189

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 134 PVGKPVVPAALMNRPTRGE 152


>SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 197

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 92  PVGKPVVPAALMNRPTRGE 110


>SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 33  PVGKPVVPAALMNRPTRGE 51


>SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 91

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 36  PVGKPVVPAALMNRPTRGE 54


>SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 287

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 232 PVGKPVVPAALMNRPTRGE 250


>SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2)
          Length = 190

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 135 PVGKPVVPAALMNRPTRGE 153


>SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 83

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 28  PVGKPVVPAALMNRPTRGE 46


>SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15)
          Length = 911

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 744 PVGKPVVPAALMNRPTRGE 762


>SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6)
          Length = 92

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 37  PVGKPVVPAALMNRPTRGE 55


>SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 239

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 134 PVGKPVVPAALMNRPTRGE 152


>SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 95  PVGKPVVPAALMNRPTRGE 113


>SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 324

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 219 PVGKPVVPAALMNRPTRGE 237


>SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3)
          Length = 150

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 45  PVGKPVVPAALMNRPTRGE 63


>SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 53  PVGKPVVPAALMNRPTRGE 71


>SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21)
          Length = 1728

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628  PVGKPVVPAALMNRPTRGE 684
            PVGKPVVPAALMNRPTRGE
Sbjct: 1673 PVGKPVVPAALMNRPTRGE 1691


>SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3)
          Length = 200

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 95  PVGKPVVPAALMNRPTRGE 113


>SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 168

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 63  PVGKPVVPAALMNRPTRGE 81


>SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1)
          Length = 409

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 107 PVGKPVVPAALMNRPTRGE 125


>SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 93  PVGKPVVPAALMNRPTRGE 111


>SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 32  PVGKPVVPAALMNRPTRGE 50


>SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 41  PVGKPVVPAALMNRPTRGE 59


>SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11)
          Length = 1903

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 935 PVGKPVVPAALMNRPTRGE 953


>SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 187

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 82  PVGKPVVPAALMNRPTRGE 100


>SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05)
          Length = 520

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 415 PVGKPVVPAALMNRPTRGE 433


>SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2)
          Length = 202

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 97  PVGKPVVPAALMNRPTRGE 115


>SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 175

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 70  PVGKPVVPAALMNRPTRGE 88


>SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6)
          Length = 190

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 85  PVGKPVVPAALMNRPTRGE 103


>SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8)
          Length = 197

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 142 PVGKPVVPAALMNRPTRGE 160


>SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 216

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 111 PVGKPVVPAALMNRPTRGE 129


>SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 152

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 47  PVGKPVVPAALMNRPTRGE 65


>SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 40  PVGKPVVPAALMNRPTRGE 58


>SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 175

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 70  PVGKPVVPAALMNRPTRGE 88


>SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 166

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 61  PVGKPVVPAALMNRPTRGE 79


>SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 38  PVGKPVVPAALMNRPTRGE 56


>SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 31  PVGKPVVPAALMNRPTRGE 49


>SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3)
          Length = 189

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 84  PVGKPVVPAALMNRPTRGE 102


>SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 117

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 62  PVGKPVVPAALMNRPTRGE 80


>SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 199

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 94  PVGKPVVPAALMNRPTRGE 112


>SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 104

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 49  PVGKPVVPAALMNRPTRGE 67


>SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4)
          Length = 160

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 55  PVGKPVVPAALMNRPTRGE 73


>SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 33  PVGKPVVPAALMNRPTRGE 51


>SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 14  PVGKPVVPAALMNRPTRGE 32


>SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1308

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 35  PVGKPVVPAALMNRPTRGE 53


>SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 44  PVGKPVVPAALMNRPTRGE 62


>SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6)
          Length = 141

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 37  PVGKPVVPAALMNRPTRGE 55


>SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3)
          Length = 180

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 75  PVGKPVVPAALMNRPTRGE 93


>SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6)
          Length = 138

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 83  PVGKPVVPAALMNRPTRGE 101


>SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1263

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/26 (73%), Positives = 23/26 (88%)
 Frame = +1

Query: 607 VALTARFPVGKPVVPAALMNRPTRGE 684
           +++  +F VGKPVVPAALMNRPTRGE
Sbjct: 379 LSMKKKFLVGKPVVPAALMNRPTRGE 404


>SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 82

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 27  PVGKPVVPAALMNRPTRGE 45


>SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6)
          Length = 127

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 37  PVGKPVVPAALMNRPTRGE 55


>SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 48  PVGKPVVPAALMNRPTRGE 66


>SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 197

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 92  PVGKPVVPAALMNRPTRGE 110


>SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 74

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 19  PVGKPVVPAALMNRPTRGE 37


>SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 32  PVGKPVVPAALMNRPTRGE 50


>SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 123

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 18  PVGKPVVPAALMNRPTRGE 36


>SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 176

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 71  PVGKPVVPAALMNRPTRGE 89


>SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 204

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 99  PVGKPVVPAALMNRPTRGE 117


>SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08)
          Length = 435

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 231 PVGKPVVPAALMNRPTRGE 249


>SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 100 PVGKPVVPAALMNRPTRGE 118


>SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 187

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 82  PVGKPVVPAALMNRPTRGE 100


>SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088)
          Length = 488

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 383 PVGKPVVPAALMNRPTRGE 401


>SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 53  PVGKPVVPAALMNRPTRGE 71


>SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7)
          Length = 177

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 72  PVGKPVVPAALMNRPTRGE 90


>SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 31  PVGKPVVPAALMNRPTRGE 49


>SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 32  PVGKPVVPAALMNRPTRGE 50


>SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 100 PVGKPVVPAALMNRPTRGE 118


>SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 82  PVGKPVVPAALMNRPTRGE 100


>SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 191

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 86  PVGKPVVPAALMNRPTRGE 104


>SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 17  PVGKPVVPAALMNRPTRGE 35


>SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 28  PVGKPVVPAALMNRPTRGE 46


>SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 191

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 77  PVGKPVVPAALMNRPTRGE 95


>SB_39336| Best HMM Match : Kinesin (HMM E-Value=0)
          Length = 558

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 453 PVGKPVVPAALMNRPTRGE 471


>SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8)
          Length = 178

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 73  PVGKPVVPAALMNRPTRGE 91


>SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 195

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 90  PVGKPVVPAALMNRPTRGE 108


>SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 78

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 23  PVGKPVVPAALMNRPTRGE 41


>SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7)
          Length = 788

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 733 PVGKPVVPAALMNRPTRGE 751


>SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 123

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 18  PVGKPVVPAALMNRPTRGE 36


>SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 32  PVGKPVVPAALMNRPTRGE 50


>SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4)
          Length = 178

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 73  PVGKPVVPAALMNRPTRGE 91


>SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 139

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 34  PVGKPVVPAALMNRPTRGE 52


>SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 44  PVGKPVVPAALMNRPTRGE 62


>SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043)
          Length = 205

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 100 PVGKPVVPAALMNRPTRGE 118


>SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 306

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 201 PVGKPVVPAALMNRPTRGE 219


>SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 211

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 106 PVGKPVVPAALMNRPTRGE 124


>SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6)
          Length = 142

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 37  PVGKPVVPAALMNRPTRGE 55


>SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 78

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 23  PVGKPVVPAALMNRPTRGE 41


>SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024)
          Length = 286

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 181 PVGKPVVPAALMNRPTRGE 199


>SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 139

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 34  PVGKPVVPAALMNRPTRGE 52


>SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 171

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 66  PVGKPVVPAALMNRPTRGE 84


>SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 36  PVGKPVVPAALMNRPTRGE 54


>SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 123

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 18  PVGKPVVPAALMNRPTRGE 36


>SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12)
          Length = 473

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 20  PVGKPVVPAALMNRPTRGE 38


>SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 51  PVGKPVVPAALMNRPTRGE 69


>SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05)
          Length = 397

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 292 PVGKPVVPAALMNRPTRGE 310


>SB_27070| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 74

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 19  PVGKPVVPAALMNRPTRGE 37


>SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 215

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 110 PVGKPVVPAALMNRPTRGE 128


>SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 51  PVGKPVVPAALMNRPTRGE 69


>SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 287

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 182 PVGKPVVPAALMNRPTRGE 200


>SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 37  PVGKPVVPAALMNRPTRGE 55


>SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4)
          Length = 370

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 265 PVGKPVVPAALMNRPTRGE 283


>SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 28  PVGKPVVPAALMNRPTRGE 46


>SB_20517| Best HMM Match : Nuclease_act (HMM E-Value=1.4)
          Length = 123

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 68  PVGKPVVPAALMNRPTRGE 86


>SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 48  PVGKPVVPAALMNRPTRGE 66


>SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1)
          Length = 568

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 463 PVGKPVVPAALMNRPTRGE 481


>SB_18568| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.5e-22)
          Length = 636

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 60  PVGKPVVPAALMNRPTRGE 78


>SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082)
          Length = 370

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 265 PVGKPVVPAALMNRPTRGE 283


>SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4)
          Length = 136

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 31  PVGKPVVPAALMNRPTRGE 49


>SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6)
          Length = 213

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 108 PVGKPVVPAALMNRPTRGE 126


>SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1)
          Length = 171

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 66  PVGKPVVPAALMNRPTRGE 84


>SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 195

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 90  PVGKPVVPAALMNRPTRGE 108


>SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 175

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 70  PVGKPVVPAALMNRPTRGE 88


>SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 212

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 107 PVGKPVVPAALMNRPTRGE 125


>SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 19  PVGKPVVPAALMNRPTRGE 37


>SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 439

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 335 PVGKPVVPAALMNRPTRGE 353


>SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 22  PVGKPVVPAALMNRPTRGE 40


>SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 596

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 541 PVGKPVVPAALMNRPTRGE 559


>SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031)
          Length = 191

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 86  PVGKPVVPAALMNRPTRGE 104


>SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05)
          Length = 198

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 143 PVGKPVVPAALMNRPTRGE 161


>SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 468

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 363 PVGKPVVPAALMNRPTRGE 381


>SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 25  PVGKPVVPAALMNRPTRGE 43


>SB_8821| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 81

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 26  PVGKPVVPAALMNRPTRGE 44


>SB_8316| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 123

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 21/26 (80%), Positives = 21/26 (80%)
 Frame = +1

Query: 607 VALTARFPVGKPVVPAALMNRPTRGE 684
           VAL     VGKPVVPAALMNRPTRGE
Sbjct: 11  VALDGILAVGKPVVPAALMNRPTRGE 36


>SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 20  PVGKPVVPAALMNRPTRGE 38


>SB_6860| Best HMM Match : zf-C3HC4 (HMM E-Value=0.14)
          Length = 129

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 74  PVGKPVVPAALMNRPTRGE 92


>SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 49  PVGKPVVPAALMNRPTRGE 67


>SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0)
          Length = 866

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 811 PVGKPVVPAALMNRPTRGE 829


>SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88)
          Length = 634

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 436 PVGKPVVPAALMNRPTRGE 454


>SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8)
          Length = 186

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/19 (100%), Positives = 19/19 (100%)
 Frame = +1

Query: 628 PVGKPVVPAALMNRPTRGE 684
           PVGKPVVPAALMNRPTRGE
Sbjct: 81  PVGKPVVPAALMNRPTRGE 99


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,792,340
Number of Sequences: 59808
Number of extensions: 446317
Number of successful extensions: 2100
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 1873
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2100
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1769412099
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).