SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0100
         (644 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6)             82   3e-16
SB_29925| Best HMM Match : GYF (HMM E-Value=6.8)                       82   3e-16
SB_12129| Best HMM Match : No HMM Matches (HMM E-Value=.)              82   3e-16
SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   6e-16
SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2)                 81   8e-16
SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_55066| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_54118| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_51190| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_48072| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_47125| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_44926| Best HMM Match : Attractin (HMM E-Value=7)                   81   8e-16
SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               81   8e-16
SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_41072| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_39827| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_38493| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_36156| Best HMM Match : Attractin (HMM E-Value=7)                   81   8e-16
SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_35086| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               81   8e-16
SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1)               81   8e-16
SB_32963| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_32499| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_30935| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_29785| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4)           81   8e-16
SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_25145| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_23790| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_22308| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_21728| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6)             81   8e-16
SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1)               81   8e-16
SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_17415| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               81   8e-16
SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7)           81   8e-16
SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_9120| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_8797| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_8779| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_8654| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_8464| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_8430| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_8410| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_8220| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_7764| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_7356| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_7349| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_7252| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_7157| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_7113| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_7085| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_6890| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_6616| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_6437| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_6037| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_5934| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_5529| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_5295| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_5042| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_5041| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_4511| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_4433| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_4372| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_4226| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_4161| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_3964| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_3933| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_2782| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_2639| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_2564| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_2287| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_2174| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_2150| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_1538| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_1504| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_1281| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_1196| Best HMM Match : No HMM Matches (HMM E-Value=.)               81   8e-16
SB_788| Best HMM Match : No HMM Matches (HMM E-Value=.)                81   8e-16
SB_721| Best HMM Match : No HMM Matches (HMM E-Value=.)                81   8e-16
SB_548| Best HMM Match : No HMM Matches (HMM E-Value=.)                81   8e-16
SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)                 81   8e-16
SB_172| Best HMM Match : No HMM Matches (HMM E-Value=.)                81   8e-16
SB_59785| Best HMM Match : TBCA (HMM E-Value=3)                        81   8e-16
SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_59546| Best HMM Match : Collagen (HMM E-Value=0.003)                81   8e-16
SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               81   8e-16
SB_59242| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_59187| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_59131| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_59001| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_58964| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_58933| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_58264| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_57917| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_57878| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_57788| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_56857| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_56195| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_56111| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_55984| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_55672| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_55664| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_55372| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_55221| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_54670| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_54625| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_54192| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_53956| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_53701| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_53637| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_53434| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_53249| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_52930| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_52839| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_52708| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_52332| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_52026| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_51920| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_51767| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_51579| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_51510| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               81   8e-16
SB_51154| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_50997| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_50427| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_50404| Best HMM Match : Pep_M12B_propep (HMM E-Value=6)             81   8e-16
SB_50393| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_50189| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_49781| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_49101| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_49042| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_48963| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_48957| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_48813| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_48453| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_48226| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_47917| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_47720| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_47666| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_47427| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_47350| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_46769| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_46630| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_46329| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_46320| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_46081| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_45450| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_45197| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_45018| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_44709| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_44370| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9)           81   8e-16
SB_44174| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_44053| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_43619| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_43572| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_43409| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_42784| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_42287| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_42013| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.8)           81   8e-16
SB_41701| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_41333| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_41310| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_41098| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_40781| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_40467| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_40329| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_40150| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_40121| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               81   8e-16
SB_40085| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_39869| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_39718| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_39341| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_38278| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_38049| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_37993| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_37765| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_37658| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_37587| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_37564| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_37354| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_37287| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_37073| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_36965| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_36882| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_36869| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_36786| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_36725| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_36717| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_36657| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_36525| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_36394| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_36031| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_35815| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_35712| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_35515| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_35475| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_35434| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_35346| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_35321| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_34847| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_34616| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_34440| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_34397| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_34379| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_34378| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_34023| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_33989| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_33474| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_33416| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_33328| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_32512| Best HMM Match : Chlam_OMP3 (HMM E-Value=4.2)                81   8e-16
SB_32361| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_32275| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_32095| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_32014| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_31990| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_31973| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_31926| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_31716| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_31547| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_31521| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_30243| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_30141| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_29531| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_29169| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_28227| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_28224| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_27489| Best HMM Match : Pep_M12B_propep (HMM E-Value=4.7)           81   8e-16
SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_26909| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_26861| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8)                    81   8e-16
SB_26658| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_25285| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_25254| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_25093| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_25043| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_24889| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_24879| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_24857| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_24789| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_24551| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_24500| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_24211| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_23617| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_23470| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_23311| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_23121| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_22956| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_22358| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_22112| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               81   8e-16
SB_21855| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_21849| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_21590| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_21571| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_21260| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_21251| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_21239| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_21222| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_21067| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_20387| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_20159| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_20100| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_20045| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_19963| Best HMM Match : His_leader (HMM E-Value=9.3)                81   8e-16
SB_19329| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_19308| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16
SB_18930| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4)           81   8e-16
SB_18891| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   8e-16

>SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6)
          Length = 149

 Score = 82.2 bits (194), Expect = 3e-16
 Identities = 38/60 (63%), Positives = 44/60 (73%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NSPPGSV + +
Sbjct: 45  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSPPGSVFDTE 104



 Score = 77.0 bits (181), Expect = 1e-14
 Identities = 36/42 (85%), Positives = 36/42 (85%)
 Frame = -1

Query: 638 MIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           MIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 1   MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42


>SB_29925| Best HMM Match : GYF (HMM E-Value=6.8)
          Length = 101

 Score = 82.2 bits (194), Expect = 3e-16
 Identities = 39/47 (82%), Positives = 39/47 (82%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILKDHR 504
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K  R
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSR 58


>SB_12129| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 82.2 bits (194), Expect = 3e-16
 Identities = 38/62 (61%), Positives = 44/62 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF P E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 45  IGHAFTVCIHTENQNQVSFYPFVPHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 104

Query: 328 HA 323
            +
Sbjct: 105 RS 106



 Score = 77.0 bits (181), Expect = 1e-14
 Identities = 36/42 (85%), Positives = 36/42 (85%)
 Frame = -1

Query: 638 MIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           MIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 1   MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42


>SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.4 bits (192), Expect = 6e-16
 Identities = 38/62 (61%), Positives = 44/62 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NSPP SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSPPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119



 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55


>SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 77.8 bits (183), Expect = 7e-15
 Identities = 37/60 (61%), Positives = 42/60 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117


>SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2)
          Length = 196

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55


>SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 13  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 59  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 118

Query: 328 HA 323
            +
Sbjct: 119 RS 120


>SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_55066| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 50  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93


>SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.6 bits (185), Expect = 4e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVGIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/62 (61%), Positives = 44/62 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_54118| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 36/62 (58%), Positives = 42/62 (67%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL L HLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLRHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 37/62 (59%), Positives = 44/62 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           +G AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D
Sbjct: 58  VGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 77.8 bits (183), Expect = 7e-15
 Identities = 37/60 (61%), Positives = 42/60 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117


>SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_51190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 77.4 bits (182), Expect = 9e-15
 Identities = 36/62 (58%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL +GHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTIGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/62 (61%), Positives = 44/62 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 50  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 77.8 bits (183), Expect = 7e-15
 Identities = 37/60 (61%), Positives = 42/60 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 96  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 155


>SB_48072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 36/62 (58%), Positives = 42/62 (67%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ  S P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPYSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_47125| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 50  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93


>SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 51  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 97  IGHAFTVCIHTENQNQVSFFPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 156

Query: 328 HA 323
            +
Sbjct: 157 RS 158


>SB_44926| Best HMM Match : Attractin (HMM E-Value=7)
          Length = 111

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 50  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93


>SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 179

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55


>SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/62 (61%), Positives = 44/62 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 77.8 bits (183), Expect = 7e-15
 Identities = 37/60 (61%), Positives = 42/60 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117


>SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 77.8 bits (183), Expect = 7e-15
 Identities = 37/60 (61%), Positives = 42/60 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117


>SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_41072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 50  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93


>SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 77.8 bits (183), Expect = 7e-15
 Identities = 37/60 (61%), Positives = 42/60 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117


>SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 50  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 96  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 155

Query: 328 HA 323
            +
Sbjct: 156 RS 157


>SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_39827| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 36/62 (58%), Positives = 42/62 (67%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL L HLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLRHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 81  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 124



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 127 IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 186

Query: 328 HA 323
            +
Sbjct: 187 RS 188


>SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_38493| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 37/62 (59%), Positives = 44/62 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           +G AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D
Sbjct: 58  VGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_36156| Best HMM Match : Attractin (HMM E-Value=7)
          Length = 162

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 50  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 96  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 155

Query: 328 HA 323
            +
Sbjct: 156 RS 157


>SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.6 bits (185), Expect = 4e-15
 Identities = 37/58 (63%), Positives = 42/58 (72%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLE 335
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV +
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFD 115


>SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 164

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 81  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 124


>SB_35086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 50  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93


>SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/62 (61%), Positives = 44/62 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 179

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55


>SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 51  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 97  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 156

Query: 328 HA 323
            +
Sbjct: 157 RS 158


>SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1)
          Length = 471

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 50  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 359 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 402



 Score = 74.5 bits (175), Expect = 7e-14
 Identities = 36/62 (58%), Positives = 42/62 (67%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL L HLRY LTDVPPQ NS P SV + D
Sbjct: 405 IGHAFTVCIHTENHNQVSFYPFVLHEISVLIELTLRHLRYRLTDVPPQPNSQPDSVFDTD 464

Query: 328 HA 323
            +
Sbjct: 465 RS 466


>SB_32963| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 35/60 (58%), Positives = 40/60 (66%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           I  AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ  S P SV + D
Sbjct: 58  IAHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPYSQPDSVFDTD 117


>SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_32499| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 13  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 59  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 118

Query: 328 HA 323
            +
Sbjct: 119 RS 120


>SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_30935| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 18  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 61



 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 36/62 (58%), Positives = 42/62 (67%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LG LRY LTDVPPQ NS P SV + D
Sbjct: 64  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGQLRYRLTDVPPQPNSQPDSVFDTD 123

Query: 328 HA 323
            +
Sbjct: 124 RS 125


>SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 77.8 bits (183), Expect = 7e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFPVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 51  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 97  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 156

Query: 328 HA 323
            +
Sbjct: 157 RS 158


>SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/62 (61%), Positives = 44/62 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D
Sbjct: 45  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTD 104

Query: 328 HA 323
            +
Sbjct: 105 RS 106



 Score = 77.0 bits (181), Expect = 1e-14
 Identities = 36/42 (85%), Positives = 36/42 (85%)
 Frame = -1

Query: 638 MIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           MIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 1   MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42


>SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/62 (61%), Positives = 44/62 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/62 (61%), Positives = 44/62 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119



 Score = 79.8 bits (188), Expect = 2e-15
 Identities = 37/44 (84%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGN+S TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNYSDTSSLKLLKTK 55


>SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_29785| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 36/62 (58%), Positives = 42/62 (67%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL L HLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLRHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4)
          Length = 128

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 77.8 bits (183), Expect = 7e-15
 Identities = 37/60 (61%), Positives = 42/60 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117


>SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/62 (61%), Positives = 44/62 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/62 (61%), Positives = 44/62 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D
Sbjct: 45  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTD 104

Query: 328 HA 323
            +
Sbjct: 105 RS 106



 Score = 77.0 bits (181), Expect = 1e-14
 Identities = 36/42 (85%), Positives = 36/42 (85%)
 Frame = -1

Query: 638 MIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           MIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 1   MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42


>SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 50  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 77.8 bits (183), Expect = 7e-15
 Identities = 37/60 (61%), Positives = 42/60 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 96  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 155


>SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_25145| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 13  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 59  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 118

Query: 328 HA 323
            +
Sbjct: 119 RS 120


>SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_23790| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 77.8 bits (183), Expect = 7e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVP Q NS PGSV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPTQPNSQPGSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 13  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 36/62 (58%), Positives = 42/62 (67%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q S  PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 59  IGHAFTVCIHTENQNQVSSYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 118

Query: 328 HA 323
            +
Sbjct: 119 RS 120


>SB_22308| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 13  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 59  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 118

Query: 328 HA 323
            +
Sbjct: 119 RS 120


>SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_21728| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 36/62 (58%), Positives = 42/62 (67%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL L HLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLRHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 30  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 73



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 76  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 135

Query: 328 HA 323
            +
Sbjct: 136 RS 137


>SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6)
          Length = 128

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1)
          Length = 276

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 164 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 207



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 210 IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 269

Query: 328 HA 323
            +
Sbjct: 270 RS 271


>SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 50  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 96  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 155

Query: 328 HA 323
            +
Sbjct: 156 RS 157


>SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_17415| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 36/62 (58%), Positives = 42/62 (67%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL L HLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLRHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 248

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 81  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 124


>SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 43  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 86



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 89  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 148

Query: 328 HA 323
            +
Sbjct: 149 RS 150


>SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7)
          Length = 207

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 37/59 (62%), Positives = 41/59 (69%), Gaps = 1/59 (1%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNS-PPGSVLE 335
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P G  LE
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDGDPLE 116


>SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 81  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 124



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 127 IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 186

Query: 328 HA 323
            +
Sbjct: 187 RS 188


>SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 77.4 bits (182), Expect = 9e-15
 Identities = 37/60 (61%), Positives = 42/60 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQESFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117


>SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 77.0 bits (181), Expect = 1e-14
 Identities = 36/62 (58%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           +G AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  MGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/62 (61%), Positives = 44/62 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 77.8 bits (183), Expect = 7e-15
 Identities = 37/60 (61%), Positives = 42/60 (70%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117


>SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.6 bits (185), Expect = 4e-15
 Identities = 38/67 (56%), Positives = 44/67 (65%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HAGVLNG 308
            +    G
Sbjct: 118 RSAKERG 124


>SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


>SB_9120| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = -1

Query: 644 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSGTSG*KLFILK 513
           FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 78.2 bits (184), Expect = 5e-15
 Identities = 37/62 (59%), Positives = 43/62 (69%)
 Frame = -2

Query: 508 IGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 329
           IG AF V + TE+ +Q SF PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D
Sbjct: 58  IGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTD 117

Query: 328 HA 323
            +
Sbjct: 118 RS 119


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,283,815
Number of Sequences: 59808
Number of extensions: 471646
Number of successful extensions: 2733
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 1945
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2732
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1633044375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).