SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0097
         (620 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_14698| Best HMM Match : E1_DerP2_DerF2 (HMM E-Value=4.1e-31)        32   0.43 
SB_4486| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.00 
SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15)            29   3.0  
SB_43766| Best HMM Match : RVT_1 (HMM E-Value=0.43)                    29   4.0  
SB_5273| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   5.3  
SB_19354| Best HMM Match : MPPN (HMM E-Value=2.9)                      27   9.3  
SB_11801| Best HMM Match : DEAD (HMM E-Value=5e-05)                    27   9.3  

>SB_14698| Best HMM Match : E1_DerP2_DerF2 (HMM E-Value=4.1e-31)
          Length = 167

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 13/42 (30%), Positives = 22/42 (52%)
 Frame = +1

Query: 331 CPTEAGKTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNESQMC 456
           CP  AG + TLD ++++    P+     K++L   DN+   C
Sbjct: 101 CPINAGDSATLDLNIYVSNLYPSLKLIIKFELKGGDNKLVFC 142


>SB_4486| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 603

 Score = 30.7 bits (66), Expect = 1.00
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
 Frame = -1

Query: 377 CKLKSKV*VLPASVGHDVSVQASHCREHQKEFQRHSSTQRGGLEFSCGELW-CKVE 213
           C + S + +   +V HD+S+  SH R   + +QR ++      +FS GE++ C +E
Sbjct: 87  CDIPSPISIHQLAVLHDLSLTLSHRRRAYELYQRAANMGHVISQFSLGEVFRCGIE 142


>SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15)
          Length = 715

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%)
 Frame = -1

Query: 299 EHQKEFQRHS-STQRGGLEFSCGELWCKV 216
           +HQ   Q  S S+Q  G+   CG LWCKV
Sbjct: 408 DHQCRLQYGSNSSQCTGMSDPCGTLWCKV 436


>SB_43766| Best HMM Match : RVT_1 (HMM E-Value=0.43)
          Length = 491

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 2/43 (4%)
 Frame = +3

Query: 81  FNVVTTRLCREVDASACT--VNEVRIDPCVNSRLCHLKKGKNA 203
           F    T+LC  +  S CT   +   I+P V SRL  L KG+ A
Sbjct: 32  FKQSATKLCDAMTKSLCTKYFDPETIEPLVASRLIPLDKGEGA 74


>SB_5273| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 11/51 (21%), Positives = 21/51 (41%)
 Frame = +1

Query: 328 SCPTEAGKTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNESQMCCYRTNVRL 480
           SCP ++G          I  + P GN   K  + + D    + C+  ++ +
Sbjct: 99  SCPVDSGVKSMFKIHQAIESEFPVGNLTLKAAVTDSDTSQVVFCFEVDLEI 149


>SB_19354| Best HMM Match : MPPN (HMM E-Value=2.9)
          Length = 290

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 9/18 (50%), Positives = 14/18 (77%)
 Frame = +1

Query: 406 FEFKWKLWNEDNESQMCC 459
           ++FK  L N+DN+ Q+CC
Sbjct: 259 YDFKLFLSNDDNKKQLCC 276


>SB_11801| Best HMM Match : DEAD (HMM E-Value=5e-05)
          Length = 1442

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 5/46 (10%)
 Frame = +3

Query: 81  FNVVTTRLCREVDA---SACT--VNEVRIDPCVNSRLCHLKKGKNA 203
           FN   T+LC  +     S CT  ++   I+P V SRL  L KG+ A
Sbjct: 96  FNQSATKLCDAIATMTKSLCTKYIDPKTIEPLVASRLIPLDKGEGA 141


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,337,149
Number of Sequences: 59808
Number of extensions: 406912
Number of successful extensions: 1049
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 937
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1049
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1536271375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).