SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0095
         (760 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.)              90   2e-18
SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.)              89   3e-18
SB_48014| Best HMM Match : No HMM Matches (HMM E-Value=.)              89   5e-18
SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.)              89   5e-18
SB_54550| Best HMM Match : No HMM Matches (HMM E-Value=.)              88   6e-18
SB_21239| Best HMM Match : No HMM Matches (HMM E-Value=.)              88   6e-18
SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   1e-17
SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   1e-17
SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   1e-17
SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   1e-17
SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   1e-17
SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   1e-17
SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_36156| Best HMM Match : Attractin (HMM E-Value=7)                   87   2e-17
SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4)           87   2e-17
SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_22505| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6)             87   2e-17
SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1)               87   2e-17
SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7)           87   2e-17
SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_9120| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_8797| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_8779| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_8654| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_8464| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_8430| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_8410| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_8220| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_7764| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_7356| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_7252| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_7157| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_7113| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_7085| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_6890| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_6616| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_6037| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_5934| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_5529| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_5295| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_5042| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_4511| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_4433| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_4372| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_4226| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_4161| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_3964| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_3933| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_2782| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_2639| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_2564| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_2174| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_2150| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_1538| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_1504| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_1281| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_1196| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_788| Best HMM Match : No HMM Matches (HMM E-Value=.)                87   2e-17
SB_721| Best HMM Match : No HMM Matches (HMM E-Value=.)                87   2e-17
SB_574| Best HMM Match : PapG_N (HMM E-Value=8)                        87   2e-17
SB_548| Best HMM Match : No HMM Matches (HMM E-Value=.)                87   2e-17
SB_172| Best HMM Match : No HMM Matches (HMM E-Value=.)                87   2e-17
SB_59785| Best HMM Match : TBCA (HMM E-Value=3)                        87   2e-17
SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_59546| Best HMM Match : Collagen (HMM E-Value=0.003)                87   2e-17
SB_59242| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_59187| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_59131| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_59001| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_58964| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_58933| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_58264| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_57917| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_57878| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_57788| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_56857| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_56195| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_56111| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_55984| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_55672| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_55664| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_55372| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_55221| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_54670| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_54625| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_54192| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_53956| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_53701| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_53637| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_53434| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_53249| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_52930| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_52839| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_52708| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_52332| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_52026| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_51920| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_51767| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_51579| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_51510| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_51154| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_50997| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_50427| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_50404| Best HMM Match : Pep_M12B_propep (HMM E-Value=6)             87   2e-17
SB_50393| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_50189| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_49781| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_49101| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_49042| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_48963| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_48957| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_48813| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_48453| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_48226| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_47917| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_47720| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_47666| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_47427| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_47350| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_46769| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_46630| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_46329| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_46320| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_46081| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_45450| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_45197| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_45018| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_44709| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_44370| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9)           87   2e-17
SB_44174| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_44053| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_43619| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_43572| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_42784| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_41701| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_41333| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_41310| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_41098| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_40781| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_40467| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_40329| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_40150| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_40121| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_40085| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_39869| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_39718| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_39341| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_38278| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_37993| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_37765| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_37658| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_37564| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_37287| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_37073| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_36965| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_36882| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_36869| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_36786| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_36725| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_36717| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_36657| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_36525| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_36394| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_36031| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_35815| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_35712| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_35515| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_35475| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_35434| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_35346| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_35321| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_34616| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_34440| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_34397| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_34379| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_34378| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_34023| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_33989| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_33474| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_33416| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_33328| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_32361| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_32275| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_32095| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_32014| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_31990| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_31973| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_31926| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_31716| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_31547| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_31521| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_30243| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_30141| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_29531| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_29169| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_28227| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_28224| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_27489| Best HMM Match : Pep_M12B_propep (HMM E-Value=4.7)           87   2e-17
SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_26909| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_26861| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_26658| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_25285| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_25254| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_25043| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_24889| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_24879| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_24857| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_24789| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_24551| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_24500| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_24211| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_23617| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_23470| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_23311| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_23121| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_22358| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_22112| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_21849| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_21590| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_21571| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_21260| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_21251| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_21222| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_21067| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_20387| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_20159| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_20100| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_20045| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_19308| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_18930| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4)           87   2e-17
SB_18891| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_18839| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_18500| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_18174| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_18144| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_17469| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_17400| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_17304| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_16489| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_16392| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_16216| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_15984| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_15494| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_15309| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_15056| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4)           87   2e-17
SB_14630| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_14484| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_14392| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_14211| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_13866| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_13789| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_13263| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_12909| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_12309| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_12306| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_12014| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_11843| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_11715| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_11470| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_11251| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_10889| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_10876| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_10874| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_10255| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_10248| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_10013| Best HMM Match : No HMM Matches (HMM E-Value=.)              87   2e-17
SB_9762| Best HMM Match : No HMM Matches (HMM E-Value=.)               87   2e-17
SB_14423| Best HMM Match : Attractin (HMM E-Value=7)                   86   3e-17
SB_51190| Best HMM Match : No HMM Matches (HMM E-Value=.)              86   3e-17
SB_43021| Best HMM Match : No HMM Matches (HMM E-Value=.)              86   3e-17
SB_41868| Best HMM Match : No HMM Matches (HMM E-Value=.)              86   3e-17
SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.)              85   4e-17
SB_5041| Best HMM Match : No HMM Matches (HMM E-Value=.)               85   4e-17
SB_21855| Best HMM Match : No HMM Matches (HMM E-Value=.)              85   4e-17
SB_32963| Best HMM Match : No HMM Matches (HMM E-Value=.)              85   8e-17
SB_43409| Best HMM Match : No HMM Matches (HMM E-Value=.)              84   1e-16
SB_54118| Best HMM Match : No HMM Matches (HMM E-Value=.)              83   2e-16
SB_48072| Best HMM Match : No HMM Matches (HMM E-Value=.)              83   2e-16
SB_39827| Best HMM Match : No HMM Matches (HMM E-Value=.)              83   2e-16
SB_29785| Best HMM Match : No HMM Matches (HMM E-Value=.)              83   2e-16
SB_23790| Best HMM Match : No HMM Matches (HMM E-Value=.)              83   2e-16

>SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 89.8 bits (213), Expect = 2e-18
 Identities = 53/109 (48%), Positives = 60/109 (55%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
              P    T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFPVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 30.7 bits (66), Expect = 1.3
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFPVCIHTENQNQVSF 76


>SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 89.4 bits (212), Expect = 3e-18
 Identities = 53/110 (48%), Positives = 60/110 (54%), Gaps = 2/110 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNSP 759
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NSP
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSP 109



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_48014| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 88.6 bits (210), Expect = 5e-18
 Identities = 41/54 (75%), Positives = 42/54 (77%)
 Frame = +3

Query: 438 GEQSNAWRILLRNDRKSRHRRIKNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           GEQSN WRILLRNDRKSRHRRIK     +AWLPQASYPCGNFS TS  KL   K
Sbjct: 2   GEQSNTWRILLRNDRKSRHRRIKKQRRYDAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 23/31 (74%), Positives = 24/31 (77%)
 Frame = +1

Query: 664 PFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
           PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 78  PFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 33.9 bits (74), Expect = 0.14
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = +2

Query: 503 QKQRRYERLAATSQXXXXXXXXXXXXXXXYTKGSIGRAFAVPMRTEHLDQASF 661
           +KQRRY+     +                 TKGS+G AF V + TE+ +Q SF
Sbjct: 24  KKQRRYDAWLPQASYPCGNFSDTSSLKLLKTKGSVGHAFTVCIHTENQNQVSF 76


>SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 88.6 bits (210), Expect = 5e-18
 Identities = 53/109 (48%), Positives = 60/109 (55%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF  RE+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLREISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_54550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 88.2 bits (209), Expect = 6e-18
 Identities = 52/108 (48%), Positives = 57/108 (52%), Gaps = 1/108 (0%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RP 612
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F    + N L  +     
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLNLLKTKGSIGH 60

Query: 613 CFRSPYAY*TSGSSQLLPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
            F               PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 61  TFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 22/24 (91%), Positives = 23/24 (95%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTS 575
           K+NVAMNAWLPQASYPCGNFS TS
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTS 47



 Score = 29.5 bits (63), Expect = 3.1
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG  F V + TE+ +Q SF
Sbjct: 54  TKGSIGHTFTVCIHTENQNQVSF 76


>SB_21239| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 88.2 bits (209), Expect = 6e-18
 Identities = 54/112 (48%), Positives = 58/112 (51%), Gaps = 5/112 (4%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTF-----LAPLAKNSLY*R 600
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F     L  L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGH 60

Query: 601 IDRPCFRSPYAY*TSGSSQLLPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
               C  +   Y  S      PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 61  AFTVCIHTENQYQVS----FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 29.5 bits (63), Expect = 3.1
 Identities = 14/23 (60%), Positives = 16/23 (69%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+  Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQYQVSF 76


>SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSVG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 30.7 bits (66), Expect = 1.3
 Identities = 13/23 (56%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGS+G AF V + TE+ +Q SF
Sbjct: 54  TKGSVGHAFTVCIHTENQNQVSF 76


>SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 40  WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 98

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 99  HAFTVCIHTENQNQVSFFPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 147



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 63  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 93  TKGSIGHAFTVCIHTENQNQVSF 115


>SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSVG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 30.7 bits (66), Expect = 1.3
 Identities = 13/23 (56%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGS+G AF V + TE+ +Q SF
Sbjct: 54  TKGSVGHAFTVCIHTENQNQVSF 76


>SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 51/108 (47%), Positives = 56/108 (51%), Gaps = 1/108 (0%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RP 612
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F    +   L  +     
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGH 60

Query: 613 CFRSPYAY*TSGSSQLLPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
            F               PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 61  AFTVCIHTENQNQESFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 30.7 bits (66), Expect = 1.3
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQESF 76


>SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSMG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55


>SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSVG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 30.7 bits (66), Expect = 1.3
 Identities = 13/23 (56%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGS+G AF V + TE+ +Q SF
Sbjct: 54  TKGSVGHAFTVCIHTENQNQVSF 76


>SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 2   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 60

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 61  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 109



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 25  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 55  TKGSIGHAFTVCIHTENQNQVSF 77


>SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 51/108 (47%), Positives = 56/108 (51%), Gaps = 1/108 (0%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RP 612
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F    +   L  +     
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGH 60

Query: 613 CFRSPYAY*TSGSSQLLPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
            F               PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 61  AFTVGIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.5 bits (68), Expect = 0.77
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVGIHTENQNQVSF 76


>SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 97

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 98  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 146



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 92  TKGSIGHAFTVCIHTENQNQVSF 114


>SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 97

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 98  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 146



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 92  TKGSIGHAFTVCIHTENQNQVSF 114


>SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 70  WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 128

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 129 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 177



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 93  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 124



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 123 TKGSIGHAFTVCIHTENQNQVSF 145


>SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_36156| Best HMM Match : Attractin (HMM E-Value=7)
          Length = 162

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 97

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 98  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 146



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 92  TKGSIGHAFTVCIHTENQNQVSF 114


>SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 40  WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 98

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 99  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 147



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 63  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 93  TKGSIGHAFTVCIHTENQNQVSF 115


>SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 2   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 60

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 61  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 109



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 25  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 55  TKGSIGHAFTVCIHTENQNQVSF 77


>SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 40  WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 98

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 99  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 147



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 63  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 93  TKGSIGHAFTVCIHTENQNQVSF 115


>SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4)
          Length = 128

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 97

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 98  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 146



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 92  TKGSIGHAFTVCIHTENQNQVSF 114


>SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 2   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 60

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 61  HAFTVCIHTENQNQVSSYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 109



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 25  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 29.9 bits (64), Expect = 2.3
 Identities = 15/29 (51%), Positives = 21/29 (72%), Gaps = 1/29 (3%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQ-ASFCLLLH 676
           TKGSIG AF V + TE+ +Q +S+  +LH
Sbjct: 55  TKGSIGHAFTVCIHTENQNQVSSYPFVLH 83


>SB_22505| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 51/108 (47%), Positives = 56/108 (51%), Gaps = 1/108 (0%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RP 612
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F    +   L  +     
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTCSLKLLKTKGSIGH 60

Query: 613 CFRSPYAY*TSGSSQLLPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
            F               PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 61  AFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 24/32 (75%), Positives = 25/32 (78%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS T   KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTCSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 2   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 60

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 61  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 109



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 25  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 55  TKGSIGHAFTVCIHTENQNQVSF 77


>SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 19  WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 77

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 78  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 126



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 42  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 73



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 72  TKGSIGHAFTVCIHTENQNQVSF 94


>SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6)
          Length = 128

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1)
          Length = 276

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 153 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 211

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 212 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 260



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 176 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 207



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 206 TKGSIGHAFTVCIHTENQNQVSF 228


>SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 39  WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 97

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 98  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 146



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 62  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 92  TKGSIGHAFTVCIHTENQNQVSF 114


>SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 32  WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 90

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 91  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 139



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 55  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 86



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 85  TKGSIGHAFTVCIHTENQNQVSF 107


>SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7)
          Length = 207

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 70  WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 128

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 129 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 177



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 93  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 124



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 123 TKGSIGHAFTVCIHTENQNQVSF 145


>SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_9120| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_8797| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 2   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 60

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 61  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 109



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 25  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 55  TKGSIGHAFTVCIHTENQNQVSF 77


>SB_8779| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_8654| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_8464| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_8430| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_8410| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_8220| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_7764| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_7356| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_7252| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_7157| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_7113| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_7085| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_6890| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_6616| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_6037| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_5934| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_5529| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_5295| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_5042| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_4511| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


>SB_4433| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 52/109 (47%), Positives = 59/109 (54%), Gaps = 2/109 (1%)
 Frame = +1

Query: 436 WVNNPTLGEFCFAMIGRADIEGSKTTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 615
           WVNNPTLGEFCFAMIGRADIEGSK+         +   P   F +  +   L        
Sbjct: 1   WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59

Query: 616 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGHLRYSLTDVPPQSNS 756
                   T   +Q+   PF   E+SVL EL LGHLRY LTDVPPQ NS
Sbjct: 60  HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNS 108



 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = +3

Query: 504 KNNVAMNAWLPQASYPCGNFSGTSC*KLFILK 599
           K+NVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 24  KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 593 TKGSIGRAFAVPMRTEHLDQASF 661
           TKGSIG AF V + TE+ +Q SF
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSF 76


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,986,942
Number of Sequences: 59808
Number of extensions: 525183
Number of successful extensions: 4302
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 2099
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4299
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 2070332524
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).