SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0091
         (727 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.)              75   8e-14
SB_1100| Best HMM Match : No HMM Matches (HMM E-Value=.)               71   1e-12
SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.)              68   9e-12
SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.)              68   9e-12
SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.)              68   9e-12
SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.)              68   9e-12
SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.)              68   9e-12
SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.)              68   9e-12
SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.)               67   1e-11
SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.)               67   1e-11
SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.)               67   1e-11
SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.)               67   1e-11
SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_18891| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_14423| Best HMM Match : Attractin (HMM E-Value=7)                   67   1e-11
SB_11715| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_9762| Best HMM Match : No HMM Matches (HMM E-Value=.)               67   1e-11
SB_7799| Best HMM Match : No HMM Matches (HMM E-Value=.)               67   1e-11
SB_3610| Best HMM Match : No HMM Matches (HMM E-Value=.)               67   1e-11
SB_2425| Best HMM Match : No HMM Matches (HMM E-Value=.)               67   1e-11
SB_25093| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   2e-11
SB_9131| Best HMM Match : No HMM Matches (HMM E-Value=.)               67   2e-11
SB_54550| Best HMM Match : No HMM Matches (HMM E-Value=.)              66   2e-11
SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.)              66   2e-11
SB_21239| Best HMM Match : No HMM Matches (HMM E-Value=.)              66   2e-11
SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.)              66   3e-11
SB_22308| Best HMM Match : No HMM Matches (HMM E-Value=.)              66   4e-11
SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6)             66   4e-11
SB_12129| Best HMM Match : No HMM Matches (HMM E-Value=.)              66   4e-11
SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.)              65   6e-11
SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.)              65   6e-11
SB_22505| Best HMM Match : No HMM Matches (HMM E-Value=.)              65   6e-11
SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.)              65   6e-11
SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.)               65   6e-11
SB_172| Best HMM Match : No HMM Matches (HMM E-Value=.)                65   6e-11
SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_38493| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_36156| Best HMM Match : Attractin (HMM E-Value=7)                   64   8e-11
SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_32499| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_25145| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6)             64   8e-11
SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1)               64   8e-11
SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_9120| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_8797| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_8779| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_8654| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_8464| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_8430| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_8410| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_8220| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_7764| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_7356| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_7252| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_7157| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_7113| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_7085| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_6890| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_6437| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_6037| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_5934| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_5529| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_5295| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_5042| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_4511| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_4433| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_4372| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_4226| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_4161| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_3964| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_3933| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_2782| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_2639| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_2564| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_2287| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_2174| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_2150| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_1538| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_1504| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_1281| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_1196| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   8e-11
SB_788| Best HMM Match : No HMM Matches (HMM E-Value=.)                64   8e-11
SB_721| Best HMM Match : No HMM Matches (HMM E-Value=.)                64   8e-11
SB_574| Best HMM Match : PapG_N (HMM E-Value=8)                        64   8e-11
SB_548| Best HMM Match : No HMM Matches (HMM E-Value=.)                64   8e-11
SB_59546| Best HMM Match : Collagen (HMM E-Value=0.003)                64   8e-11
SB_59242| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_59187| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_59001| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_58964| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_58933| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_58264| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_57917| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_57878| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_57788| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_56857| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_56195| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_56111| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_55984| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_55672| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_55664| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_55372| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_55221| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_54670| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_54625| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_54192| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_53956| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_53701| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_53637| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_53434| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_53249| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_52930| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_52839| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_52708| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_52332| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_52026| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_51920| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_51767| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_51579| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_51510| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_51154| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_50997| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_50427| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_50404| Best HMM Match : Pep_M12B_propep (HMM E-Value=6)             64   8e-11
SB_50393| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_50189| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_49781| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_49101| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_49042| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_48963| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_48957| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_48813| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_48453| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_48226| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_47917| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_47720| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_47666| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_47427| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_47350| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_46769| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_46630| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_46329| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_46320| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_46081| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_45450| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_45197| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_45018| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_44709| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_44370| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9)           64   8e-11
SB_44174| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_44053| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_43619| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_43572| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_42784| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_41701| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_41333| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_41098| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_40781| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_40467| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_40329| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_40150| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_40121| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_40085| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_39869| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_39718| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_39341| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_38278| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_38049| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_37993| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_37765| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_37658| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_37564| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_37287| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_37073| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_36965| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_36882| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_36869| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_36786| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_36725| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_36717| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_36657| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_36525| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_36394| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_36031| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_35815| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_35515| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_35475| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_35434| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_35346| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_35321| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_34847| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_34616| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_34440| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_34397| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_34379| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_34378| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_34023| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_33989| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_33474| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_33416| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_33328| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_32361| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_32275| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_32095| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_32014| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_31990| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_31973| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_31926| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_31716| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_31521| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_30243| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_30141| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_29531| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_29169| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_28227| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_28224| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_27489| Best HMM Match : Pep_M12B_propep (HMM E-Value=4.7)           64   8e-11
SB_26909| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_26861| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_26658| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_25285| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_25254| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_25043| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_24889| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_24879| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_24857| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_24789| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_24551| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_24500| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_24211| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_23617| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_23470| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_23311| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_23121| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_22358| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_22112| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_21849| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_21590| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_21571| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_21260| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_21251| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_21222| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_21067| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_20387| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_20159| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_20100| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_20045| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_19329| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_19308| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_18930| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4)           64   8e-11
SB_18839| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_18500| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_18174| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_18144| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_17469| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_17400| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_17342| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_17304| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_16538| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_16489| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_16392| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_16216| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_15984| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_15494| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_15309| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_15056| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4)           64   8e-11
SB_14630| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_14484| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_14392| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_14211| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_13866| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   8e-11
SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9)                   64   1e-10
SB_43021| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_33457| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_54410| Best HMM Match : No HMM Matches (HMM E-Value=.)              63   3e-10
SB_48941| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   3e-10
SB_48014| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   4e-10
SB_17546| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   4e-10
SB_34583| Best HMM Match : Chlam_OMP3 (HMM E-Value=2.4)                62   4e-10
SB_56722| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_56542| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_56484| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_56050| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_53318| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9)           62   6e-10
SB_53107| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9)           62   6e-10
SB_51655| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_49414| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_48354| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_46716| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_44048| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_43745| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_43288| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_42472| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_41544| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_40967| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10

>SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 74.5 bits (175), Expect = 8e-14
 Identities = 41/66 (62%), Positives = 48/66 (72%)
 Frame = -2

Query: 279 LPPNRVSNEQ*K*WFFSDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAV 100
           LP +R+S +  +   F   R   +PTY+TPLMS +  RLESSSTGSSFPAD  KPVPLAV
Sbjct: 67  LPLHRISKKTIRVVVFH--RRIATPTYSTPLMSFHRVRLESSSTGSSFPADCAKPVPLAV 124

Query: 99  VSLDSR 82
           VSLDSR
Sbjct: 125 VSLDSR 130


>SB_1100| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 46/108 (42%), Positives = 53/108 (49%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+        HKP +P   F    +   L  +      F         
Sbjct: 11  FAMIGRADIEGSKSNVAMNAWLHKP-LPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 69

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 70  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 117



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 23/34 (67%), Positives = 24/34 (70%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWL +   PCGNFS TS  KL   K
Sbjct: 21  GSKSNVAMNAWLHKP-LPCGNFSDTSSLKLLKTK 53



 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 1/29 (3%)
 Frame = -2

Query: 573 TKGSIGRVFAVPMRTEHLDQASF-ALLLH 490
           TKGSIG  F V + TE+ +Q SF   +LH
Sbjct: 52  TKGSIGHAFTVCIHTENQNQVSFYPFVLH 80


>SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.7 bits (158), Expect = 9e-12
 Identities = 45/109 (41%), Positives = 53/109 (48%), Gaps = 2/109 (1%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPCFRSPYAY*TSG 518
           FAMIGRADIE  K+         +   P   F +  +   L                T  
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSVGHAFTVCIHTEN 70

Query: 517 SSQ--FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
            +Q  F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 71  QNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 26/81 (32%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGS+G  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSVGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.7 bits (158), Expect = 9e-12
 Identities = 45/109 (41%), Positives = 53/109 (48%), Gaps = 2/109 (1%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPCFRSPYAY*TSG 518
           FAMIGRADIE  K+         +   P   F +  +   L                T  
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSVGHAFTVCIHTEN 70

Query: 517 SSQ--FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
            +Q  F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 71  QNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 26/81 (32%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGS+G  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSVGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.7 bits (158), Expect = 9e-12
 Identities = 45/109 (41%), Positives = 53/109 (48%), Gaps = 2/109 (1%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPCFRSPYAY*TSG 518
           FAMIGRADIE  K+         +   P   F +  +   L           P    T  
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIGHAFPVCIHTEN 70

Query: 517 SSQ--FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
            +Q  F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 71  QNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FPVCIHTENQNQVSFYPFVLH 82


>SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.7 bits (158), Expect = 9e-12
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NSPP SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSPPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.7 bits (158), Expect = 9e-12
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIPTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 33.5 bits (73), Expect = 0.18
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIPTENQNQVSFYPFVLH 82


>SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.7 bits (158), Expect = 9e-12
 Identities = 45/109 (41%), Positives = 53/109 (48%), Gaps = 2/109 (1%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPCFRSPYAY*TSG 518
           FAMIGRADIE  K+         +   P   F +  +   L                T  
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSVGHAFTVCIHTEN 70

Query: 517 SSQ--FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
            +Q  F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 71  QNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 26/81 (32%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGS+G  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSVGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 51  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 110

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 111 NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 158



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 61  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 41  VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 100

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 101 FTVCIHTENQNQVSFYPFVLH 121


>SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 51  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 110

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 111 NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 158



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 61  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 41  VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 100

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 101 FTVCIHTENQNQVSFYPFVLH 121


>SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_18891| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_14423| Best HMM Match : Attractin (HMM E-Value=7)
          Length = 162

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 50  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSVGHAFTVCIHAENQ 109

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 110 NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 157



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 60  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93


>SB_11715| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_9762| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_7799| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_3610| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_2425| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_25093| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIERSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 27/33 (81%), Positives = 27/33 (81%)
 Frame = -3

Query: 665 SKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           SKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 23  SKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 37.1 bits (82), Expect = 0.014
 Identities = 28/81 (34%), Positives = 34/81 (41%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +        R K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIERSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_9131| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 66.9 bits (156), Expect = 2e-11
 Identities = 44/106 (41%), Positives = 50/106 (47%), Gaps = 1/106 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 383
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTD 117



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_54550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    + N L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLNLLKTKGSIGHTFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 25/26 (96%), Positives = 25/26 (96%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTS 591
           GSKSNVAMNAWLPQASYPCGNFS TS
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTS 47



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLNLLKTKGSIGHT 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 44/108 (40%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF  RE+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLREISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 25/75 (33%), Positives = 30/75 (40%), Gaps = 1/75 (1%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF 505
           F V + TE+ +Q SF
Sbjct: 62  FTVCIHTENQNQVSF 76


>SB_21239| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 46/112 (41%), Positives = 52/112 (46%), Gaps = 5/112 (4%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTF-----LAPLAKNSLY*RIDRPCFRSPYA 533
           FAMIGRADIE  K+         +   P   F     L  L            C  +   
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 532 Y*TSGSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
           Y  S    F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  YQVS----FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 32.7 bits (71), Expect = 0.31
 Identities = 27/81 (33%), Positives = 32/81 (39%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+  Q SF   +LH
Sbjct: 62  FTVCIHTENQYQVSFYPFVLH 82


>SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 66.1 bits (154), Expect = 3e-11
 Identities = 43/108 (39%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   +    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNYSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 119



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 27/34 (79%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGN+S TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNYSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNYSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_22308| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 65.7 bits (153), Expect = 4e-11
 Identities = 44/118 (37%), Positives = 52/118 (44%), Gaps = 1/118 (0%)
 Frame = -1

Query: 727 GEQSNAWRILFAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPC 551
           G+        FAMIGRADIE  K+         +   P   F    +   L  +      
Sbjct: 2   GDNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 550 FRSPYAY*TSGSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
           F             F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 62  FTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 30.7 bits (66), Expect = 1.3
 Identities = 25/80 (31%), Positives = 32/80 (40%), Gaps = 2/80 (2%)
 Frame = -2

Query: 723 NNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRVF 547
           +NPTLGEFC +          K           +               L TKGSIG  F
Sbjct: 3   DNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAF 62

Query: 546 AVPMRTEHLDQASF-ALLLH 490
            V + TE+ +Q SF   +LH
Sbjct: 63  TVCIHTENQNQVSFYPFVLH 82


>SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6)
          Length = 149

 Score = 65.7 bits (153), Expect = 4e-11
 Identities = 29/42 (69%), Positives = 32/42 (76%)
 Frame = -1

Query: 508 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPD 383
           F PF   E+SVL EL LGHLRY LTDVPPQ NSPPGSV + +
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSPPGSVFDTE 104



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 9   GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42



 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 1/29 (3%)
 Frame = -2

Query: 573 TKGSIGRVFAVPMRTEHLDQASF-ALLLH 490
           TKGSIG  F V + TE+ +Q SF   +LH
Sbjct: 41  TKGSIGHAFTVCIHTENQNQVSFYPFVLH 69


>SB_12129| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 65.7 bits (153), Expect = 4e-11
 Identities = 29/44 (65%), Positives = 32/44 (72%)
 Frame = -1

Query: 508 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
           F PF P E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 63  FYPFVPHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 106



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 9   GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42



 Score = 29.5 bits (63), Expect = 2.9
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = -2

Query: 573 TKGSIGRVFAVPMRTEHLDQASF 505
           TKGSIG  F V + TE+ +Q SF
Sbjct: 41  TKGSIGHAFTVCIHTENQNQVSF 63


>SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVGIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.7 bits (76), Expect = 0.077
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVGIHTENQNQVSFYPFVLH 82


>SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 43/104 (41%), Positives = 49/104 (47%), Gaps = 1/104 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLE 389
               F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFD 115



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_22505| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTCSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 27/34 (79%), Positives = 27/34 (79%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS T   KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTCSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTCSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRP-CFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSMGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55


>SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 44/113 (38%), Positives = 51/113 (45%), Gaps = 1/113 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAGVLNG 362
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +    G
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSAKERG 124



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_172| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 121

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 45/111 (40%), Positives = 52/111 (46%), Gaps = 1/111 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAGVL 368
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D  G+L
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDR-GIL 121



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 13  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 72

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 73  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 120



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 23  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 3   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 62

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 63  FTVCIHTENQNQVSFYPFVLH 83


>SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 51  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 110

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 111 NQVSFFPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 158



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 61  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 41  VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 100

Query: 549 FAVPMRTEHLDQAS-FALLLH 490
           F V + TE+ +Q S F  +LH
Sbjct: 101 FTVCIHTENQNQVSFFPFVLH 121


>SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 50  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 109

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 110 NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 157



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 60  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 40  VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 99

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 100 FTVCIHTENQNQVSFYPFVLH 120


>SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 81  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 140

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 141 NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 188



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 91  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 124



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 71  VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 130

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 131 FTVCIHTENQNQVSFYPFVLH 151


>SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_38493| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 33.1 bits (72), Expect = 0.24
 Identities = 26/81 (32%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           +NNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   MNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_36156| Best HMM Match : Attractin (HMM E-Value=7)
          Length = 162

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 50  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 109

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 110 NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 157



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 60  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 40  VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 99

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 100 FTVCIHTENQNQVSFYPFVLH 120


>SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 51  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 110

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 111 NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 158



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 61  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 41  VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 100

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 101 FTVCIHTENQNQVSFYPFVLH 121


>SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_32499| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 1/29 (3%)
 Frame = -2

Query: 573 TKGSIGRVFAVPMRTEHLDQASF-ALLLH 490
           TKGSIG  F V + TE+ +Q SF   +LH
Sbjct: 54  TKGSIGHAFTVCIHTENQNQVSFYPFVLH 82


>SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 13  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 72

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 73  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 120



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 23  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 3   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 62

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 63  FTVCIHTENQNQVSFYPFVLH 83


>SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 51  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 110

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 111 NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 158



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 61  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 41  VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 100

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 101 FTVCIHTENQNQVSFYPFVLH 121


>SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 29/44 (65%), Positives = 32/44 (72%)
 Frame = -1

Query: 508 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
           F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 106



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 9   GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42



 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 1/29 (3%)
 Frame = -2

Query: 573 TKGSIGRVFAVPMRTEHLDQASF-ALLLH 490
           TKGSIG  F V + TE+ +Q SF   +LH
Sbjct: 41  TKGSIGHAFTVCIHTENQNQVSFYPFVLH 69


>SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 29/44 (65%), Positives = 32/44 (72%)
 Frame = -1

Query: 508 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
           F PF   E+SVL EL LGHLRY LTDVPPQ NS PGSV + D +
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRS 106



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 9   GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42



 Score = 29.9 bits (64), Expect = 2.2
 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 1/29 (3%)
 Frame = -2

Query: 573 TKGSIGRVFAVPMRTEHLDQASF-ALLLH 490
           TKGSIG  F V + TE+ +Q SF   +LH
Sbjct: 41  TKGSIGHAFTVCIHTENQNQVSFYPFVLH 69


>SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_25145| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 13  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 72

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 73  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 120



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 23  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 3   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 62

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 63  FTVCIHTENQNQVSFYPFVLH 83


>SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 13  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 72

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 73  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 120



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 23  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 3   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 62

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 63  FTVCIHTENQNQVSFYPFVLH 83


>SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 30  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 89

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 90  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 137



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 40  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 73



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 20  VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 79

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 80  FTVCIHTENQNQVSFYPFVLH 100


>SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6)
          Length = 128

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1)
          Length = 276

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 164 FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 223

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 224 NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 271



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 174 GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 207



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 154 VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 213

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 214 FTVCIHTENQNQVSFYPFVLH 234


>SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 50  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 109

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 110 NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 157



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 60  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 40  VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 99

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 100 FTVCIHTENQNQVSFYPFVLH 120


>SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 43  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 102

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 103 NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 150



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 53  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 86



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 33  VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 92

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 93  FTVCIHTENQNQVSFYPFVLH 113


>SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 81  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 140

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 141 NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 188



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 91  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 124



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 71  VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 130

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 131 FTVCIHTENQNQVSFYPFVLH 151


>SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_9120| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


>SB_8797| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 13  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 72

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 73  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 120



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 23  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 3   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 62

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 63  FTVCIHTENQNQVSFYPFVLH 83


>SB_8779| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 43/108 (39%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = -1

Query: 697 FAMIGRADIEDQKATSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RPCFRSPYAY*TS 521
           FAMIGRADIE  K+         +   P   F    +   L  +      F         
Sbjct: 12  FAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQ 71

Query: 520 GSSQFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 377
               F PF   E+SVL EL LGHLRY LTDVPPQ NS P SV + D +
Sbjct: 72  NQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRS 119



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/34 (82%), Positives = 28/34 (82%)
 Frame = -3

Query: 668 GSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILK 567
           GSKSNVAMNAWLPQASYPCGNFS TS  KL   K
Sbjct: 22  GSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55



 Score = 34.3 bits (75), Expect = 0.10
 Identities = 27/81 (33%), Positives = 33/81 (40%), Gaps = 2/81 (2%)
 Frame = -2

Query: 726 VNNPTLGEFC-SQ**EEPTSRIKKQRRYERLAATSQXXXXXXXXXXXXXXLYTKGSIGRV 550
           VNNPTLGEFC +          K           +               L TKGSIG  
Sbjct: 2   VNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHA 61

Query: 549 FAVPMRTEHLDQASF-ALLLH 490
           F V + TE+ +Q SF   +LH
Sbjct: 62  FTVCIHTENQNQVSFYPFVLH 82


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,179,379
Number of Sequences: 59808
Number of extensions: 545127
Number of successful extensions: 4839
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 1996
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4831
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1937927537
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).