SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0086
         (739 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.)              53   3e-07
SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   5e-07
SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5)                     47   2e-05
SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35)                 42   5e-04
SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.74 
SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.3  
SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76)                 30   2.3  
SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.0  
SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37)                 28   9.1  
SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11)                   28   9.1  
SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.1  
SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15)                28   9.1  
SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30)                    28   9.1  
SB_39271| Best HMM Match : Secretin_N (HMM E-Value=2.4)                28   9.1  
SB_36990| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.1  
SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.1  
SB_31551| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37)                 28   9.1  
SB_27585| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.1  
SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29)                   28   9.1  
SB_14634| Best HMM Match : ATP-synt_E (HMM E-Value=2.6)                28   9.1  
SB_12900| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.1  
SB_9508| Best HMM Match : Secretin_N (HMM E-Value=1.8)                 28   9.1  

>SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 22/27 (81%), Positives = 23/27 (85%)
 Frame = +2

Query: 389 MPRHLISDAHEWINEIPTVPIYYLAKP 469
           MPRHLISDAHEWINEIPTVPI    +P
Sbjct: 1   MPRHLISDAHEWINEIPTVPIIEFLQP 27


>SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 2/68 (2%)
 Frame = -3

Query: 647 LPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRV--SFPADSPKPVPL 474
           LP +R+S +T++VVVF RR    I+   Y++ +    + R++ +    SFPAD  KPVPL
Sbjct: 67  LPLHRISKKTIRVVVFHRR----IATPTYSTPLMSFHRVRLESSSTGSSFPADCAKPVPL 122

Query: 473 AVVSLDSR 450
           AVVSLDSR
Sbjct: 123 AVVSLDSR 130


>SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5)
          Length = 167

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 21/24 (87%), Positives = 22/24 (91%)
 Frame = +3

Query: 306 SALNVNVKKFKQARVNGGSNYDSL 377
           +ALNV VKKF QARVNGGSNYDSL
Sbjct: 28  AALNVKVKKFNQARVNGGSNYDSL 51


>SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/23 (86%), Positives = 20/23 (86%)
 Frame = +3

Query: 309 ALNVNVKKFKQARVNGGSNYDSL 377
           ALNV VKKF QARVNG SNYDSL
Sbjct: 2   ALNVKVKKFNQARVNGWSNYDSL 24


>SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35)
          Length = 521

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 17/22 (77%), Positives = 19/22 (86%)
 Frame = -2

Query: 318 HSEHWAEITLRQHPRGPSQCFV 253
           ++EHWAEITLRQH   PSQCFV
Sbjct: 48  NNEHWAEITLRQHRFRPSQCFV 69


>SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 18/24 (75%), Positives = 19/24 (79%)
 Frame = +3

Query: 303 PSALNVNVKKFKQARVNGGSNYDS 374
           PSALNV VKKF QARVNGG   +S
Sbjct: 31  PSALNVKVKKFNQARVNGGDPLES 54


>SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1199

 Score = 31.5 bits (68), Expect = 0.74
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%)
 Frame = -2

Query: 210  LTVERRSYRIVPIAHETKPTRPYG*EDPRKA-GERGSGSSPKRKT 79
            L+V  R Y++VP++HE          + R A   +GSGSSP R T
Sbjct: 1038 LSVSGRCYKVVPLSHELCLVSKSLWNNRRSADNPKGSGSSPTRDT 1082


>SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 638

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 13/30 (43%), Positives = 15/30 (50%)
 Frame = -3

Query: 719 PATSPLCTLGTKHRAPADIIDRAPLPPNRV 630
           P   P    GT HR PA+   R  +P NRV
Sbjct: 510 PTNFPESVPGTHHRVPAEATGRVDVPDNRV 539


>SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76)
          Length = 250

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 13/30 (43%), Positives = 15/30 (50%)
 Frame = -3

Query: 719 PATSPLCTLGTKHRAPADIIDRAPLPPNRV 630
           P   P    GT HR PA+   R  +P NRV
Sbjct: 216 PTNFPESVPGTHHRVPAEATGRVDVPDNRV 245


>SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3293

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 27/96 (28%), Positives = 41/96 (42%)
 Frame = -3

Query: 719  PATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 540
            PA+S +   G +H AP  IID  P   +++   T KV V++  ++ T  H    S  S Q
Sbjct: 740  PASSRI--KGFEHNAPQPIIDEGP-DTSQLRPRTSKVAVWE-TAQATTQHSESVSETSPQ 795

Query: 539  CQTRVKLNRVSFPADSPKPVPLAVVSLDSR*GQWES 432
              +  +      PA        +  SL +R   W S
Sbjct: 796  LSSTAQQTPPHSPATRHNARTSSPQSLATRHNAWTS 831


>SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37)
          Length = 732

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = +2

Query: 566 ISGRSFRAIVAEKPLLSLFH 625
           + GR F  I   KPLLSLFH
Sbjct: 374 VFGRDFDIITDHKPLLSLFH 393


>SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11)
          Length = 3037

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 11/33 (33%), Positives = 21/33 (63%)
 Frame = -3

Query: 674  PADIIDRAPLPPNRVSNETMKVVVFQRRSRETI 576
            PA + +++PLP N  ++E  +++  QRR  E +
Sbjct: 2409 PAKLPNQSPLPNNASASEIQRILENQRREEELL 2441


>SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1829

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = +2

Query: 566  ISGRSFRAIVAEKPLLSLFH 625
            + GR F  I   KPLLSLFH
Sbjct: 1317 VFGRDFDIITDHKPLLSLFH 1336


>SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15)
          Length = 710

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = +2

Query: 566 ISGRSFRAIVAEKPLLSLFH 625
           + GR F  I   KPLLSLFH
Sbjct: 79  VFGRDFDIITDHKPLLSLFH 98


>SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30)
          Length = 1280

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = +2

Query: 566 ISGRSFRAIVAEKPLLSLFH 625
           + GR F  I   KPLLSLFH
Sbjct: 608 VFGRDFDIITDHKPLLSLFH 627


>SB_39271| Best HMM Match : Secretin_N (HMM E-Value=2.4)
          Length = 300

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = +2

Query: 566 ISGRSFRAIVAEKPLLSLFH 625
           + GR F  I   KPLLSLFH
Sbjct: 259 VFGRDFDIITDHKPLLSLFH 278


>SB_36990| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 254

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = -1

Query: 187 QNRADRARNETDTTLRLGRSAEGRRTRVR 101
           +NRA RA  +    L+  R  EGRRTR R
Sbjct: 52  ENRALRAHRKCGIILQAFRKFEGRRTRTR 80


>SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1089

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = +2

Query: 566 ISGRSFRAIVAEKPLLSLFH 625
           + GR F  I   KPLLSLFH
Sbjct: 568 VFGRDFDIITDHKPLLSLFH 587


>SB_31551| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37)
          Length = 429

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = +2

Query: 566 ISGRSFRAIVAEKPLLSLFH 625
           + GR F  I   KPLLSLFH
Sbjct: 347 VFGRDFDIITDHKPLLSLFH 366


>SB_27585| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 226

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = +2

Query: 566 ISGRSFRAIVAEKPLLSLFH 625
           + GR F  I   KPLLSLFH
Sbjct: 167 VFGRDFDIITDHKPLLSLFH 186


>SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29)
          Length = 1544

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = +2

Query: 566 ISGRSFRAIVAEKPLLSLFH 625
           + GR F  I   KPLLSLFH
Sbjct: 773 VFGRDFDIITDHKPLLSLFH 792


>SB_14634| Best HMM Match : ATP-synt_E (HMM E-Value=2.6)
          Length = 309

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = +2

Query: 566 ISGRSFRAIVAEKPLLSLFH 625
           + GR F  I   KPLLSLFH
Sbjct: 167 VFGRDFDIITDHKPLLSLFH 186


>SB_12900| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 883

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = +2

Query: 566 ISGRSFRAIVAEKPLLSLFH 625
           + GR F  I   KPLLSLFH
Sbjct: 608 VFGRDFDIITDHKPLLSLFH 627


>SB_9508| Best HMM Match : Secretin_N (HMM E-Value=1.8)
          Length = 391

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 12/20 (60%), Positives = 13/20 (65%)
 Frame = +2

Query: 566 ISGRSFRAIVAEKPLLSLFH 625
           + GR F  I   KPLLSLFH
Sbjct: 241 VFGRDFDIITDHKPLLSLFH 260


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,541,883
Number of Sequences: 59808
Number of extensions: 507688
Number of successful extensions: 1195
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 1104
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1192
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1986074805
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).