SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0085
         (691 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   1e-09
SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   5e-09
SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   7e-06
SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   7e-06
SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   9e-05
SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   5e-04
SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   5e-04
SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   5e-04
SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.)                34   0.094
SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.094
SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.094
SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.094
SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.094
SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.12 
SB_35396| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.2  
SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.2  

>SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 32/40 (80%), Positives = 34/40 (85%)
 Frame = -3

Query: 125 SWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 6
           SWI  RRT+AKAFAK VFINQERKLE RRR DT LVLT+N
Sbjct: 4   SWIYERRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43


>SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 29/35 (82%), Positives = 31/35 (88%)
 Frame = -3

Query: 110 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 6
           RRT+AKAFAK VFINQERKLE RRR DT LVLT+N
Sbjct: 9   RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43


>SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 29/35 (82%), Positives = 31/35 (88%)
 Frame = -3

Query: 110 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 6
           RRT+AKAFAK VFINQERKLE RRR DT LVLT+N
Sbjct: 9   RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43


>SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 29/35 (82%), Positives = 31/35 (88%)
 Frame = -3

Query: 110 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 6
           RRT+AKAFAK VFINQERKLE RRR DT LVLT+N
Sbjct: 9   RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43


>SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 48

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 29/35 (82%), Positives = 31/35 (88%)
 Frame = -3

Query: 110 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 6
           RRT+AKAFAK VFINQERKLE RRR DT LVLT+N
Sbjct: 11  RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 45


>SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 28/34 (82%), Positives = 30/34 (88%)
 Frame = -3

Query: 107 RTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 6
           RT+AKAFAK VFINQERKLE RRR DT LVLT+N
Sbjct: 29  RTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 62


>SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 23/27 (85%), Positives = 24/27 (88%)
 Frame = -3

Query: 107 RTSAKAFAKGVFINQERKLEVRRRLDT 27
           RT+AKAFAK VFINQERKLE RRR DT
Sbjct: 2   RTTAKAFAKNVFINQERKLEDRRRSDT 28


>SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 24/36 (66%), Positives = 29/36 (80%), Gaps = 1/36 (2%)
 Frame = -3

Query: 110 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 6
           R+T+  ++ AK VFINQERKLE RRR DT LVLT+N
Sbjct: 8   RKTNYCESIAKNVFINQERKLEDRRRSDTVLVLTIN 43



 Score = 29.5 bits (63), Expect = 2.7
 Identities = 14/27 (51%), Positives = 16/27 (59%)
 Frame = -2

Query: 132 VKFLDRRKTNISESICQRCFHQSRTKV 52
           VKFLD RKTN  ESI +  F     K+
Sbjct: 2   VKFLDLRKTNYCESIAKNVFINQERKL 28


>SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 22/36 (61%), Positives = 28/36 (77%), Gaps = 1/36 (2%)
 Frame = -3

Query: 110 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 6
           R+T+  ++  + VFINQERKLE RRR DT LVLT+N
Sbjct: 8   RKTNYCESICQDVFINQERKLEDRRRSDTVLVLTIN 43



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 16/27 (59%), Positives = 17/27 (62%)
 Frame = -2

Query: 132 VKFLDRRKTNISESICQRCFHQSRTKV 52
           VKFLD RKTN  ESICQ  F     K+
Sbjct: 2   VKFLDLRKTNYCESICQDVFINQERKL 28


>SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%)
 Frame = -3

Query: 110 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 6
           R+T+  ++  +  FINQERKLE RRR DT LVLT+N
Sbjct: 8   RKTNYCESICQECFINQERKLEDRRRSDTVLVLTIN 43



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = -2

Query: 129 KFLDRRKTNISESICQRCFHQSRTKV 52
           + L  RKTN  ESICQ CF     K+
Sbjct: 3   EILGFRKTNYCESICQECFINQERKL 28


>SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%)
 Frame = -3

Query: 110 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 6
           R+T+  ++  +  FINQERKLE RRR DT LVLT+N
Sbjct: 8   RKTNYCESICQECFINQERKLEDRRRSDTVLVLTIN 43



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 17/27 (62%), Positives = 18/27 (66%)
 Frame = -2

Query: 132 VKFLDRRKTNISESICQRCFHQSRTKV 52
           VKFLD RKTN  ESICQ CF     K+
Sbjct: 2   VKFLDLRKTNYCESICQECFINQERKL 28


>SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%)
 Frame = -3

Query: 110 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 6
           R+T+  ++  +  FINQERKLE RRR DT LVLT+N
Sbjct: 8   RKTNYCESICQECFINQERKLEDRRRSDTVLVLTIN 43



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 17/27 (62%), Positives = 18/27 (66%)
 Frame = -2

Query: 132 VKFLDRRKTNISESICQRCFHQSRTKV 52
           VKFLD RKTN  ESICQ CF     K+
Sbjct: 2   VKFLDLRKTNYCESICQECFINQERKL 28


>SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 67

 Score = 34.3 bits (75), Expect = 0.094
 Identities = 15/20 (75%), Positives = 18/20 (90%)
 Frame = -3

Query: 518 SSRVIPAPIAYTKIVAVKKL 459
           ++ VIPAPIAY K+VAVKKL
Sbjct: 34  AAAVIPAPIAYIKVVAVKKL 53


>SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 112

 Score = 34.3 bits (75), Expect = 0.094
 Identities = 15/20 (75%), Positives = 18/20 (90%)
 Frame = -3

Query: 518 SSRVIPAPIAYTKIVAVKKL 459
           ++ VIPAPIAY K+VAVKKL
Sbjct: 79  AAAVIPAPIAYIKVVAVKKL 98


>SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 180

 Score = 34.3 bits (75), Expect = 0.094
 Identities = 15/20 (75%), Positives = 18/20 (90%)
 Frame = -3

Query: 518 SSRVIPAPIAYTKIVAVKKL 459
           ++ VIPAPIAY K+VAVKKL
Sbjct: 71  AAAVIPAPIAYIKVVAVKKL 90



 Score = 27.9 bits (59), Expect = 8.2
 Identities = 11/18 (61%), Positives = 16/18 (88%)
 Frame = -1

Query: 562 LNILTRNNWRASLVPAAA 509
           ++++ R +WRASLVPAAA
Sbjct: 56  MHLVIRIHWRASLVPAAA 73


>SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 34.3 bits (75), Expect = 0.094
 Identities = 15/20 (75%), Positives = 18/20 (90%)
 Frame = -3

Query: 518 SSRVIPAPIAYTKIVAVKKL 459
           ++ VIPAPIAY K+VAVKKL
Sbjct: 24  AAAVIPAPIAYIKVVAVKKL 43


>SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 34.3 bits (75), Expect = 0.094
 Identities = 15/20 (75%), Positives = 18/20 (90%)
 Frame = -3

Query: 518 SSRVIPAPIAYTKIVAVKKL 459
           ++ VIPAPIAY K+VAVKKL
Sbjct: 11  AAAVIPAPIAYIKVVAVKKL 30


>SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 40

 Score = 33.9 bits (74), Expect = 0.12
 Identities = 15/17 (88%), Positives = 16/17 (94%)
 Frame = -3

Query: 509 VIPAPIAYTKIVAVKKL 459
           VIPAPIAY K+VAVKKL
Sbjct: 10  VIPAPIAYIKVVAVKKL 26


>SB_35396| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 53

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = -1

Query: 193 QNSEVMINRDNWGHSY-CDVRGEILGSSQDEHQRKHLP 83
           Q  EV  +++  GH Y C   GE++ S++D H+   +P
Sbjct: 7   QCKEVESSKEILGHPYVCAFAGEVIQSTEDVHKPSWIP 44


>SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1024

 Score = 27.9 bits (59), Expect = 8.2
 Identities = 10/40 (25%), Positives = 22/40 (55%)
 Frame = +2

Query: 194 KTNKIEPRSYSIIPCTKYSSTFLARFEHSNLFKVKLSAHL 313
           K + ++   Y+ +    +S     RFEH+N  ++KL+ ++
Sbjct: 725 KNHSVDKHDYNNVTPLLFSQERFERFEHNNSLEIKLTVNI 764


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,849,281
Number of Sequences: 59808
Number of extensions: 426525
Number of successful extensions: 1075
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 1010
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1074
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1793485733
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).