SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0081
         (629 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   1e-05
SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   7e-04
SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.036
SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.047
SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.14 
SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5)            29   4.1  
SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0)                28   7.2  
SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.2  
SB_55246| Best HMM Match : DUF1168 (HMM E-Value=0.32)                  27   9.5  

>SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 21/24 (87%), Positives = 22/24 (91%)
 Frame = -3

Query: 399 DVVAVSQAPSPESNPDSPLPVTTM 328
           DVVAVSQAPSPESNP+SP PV TM
Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128


>SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 212

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 18/21 (85%), Positives = 19/21 (90%)
 Frame = -3

Query: 390 AVSQAPSPESNPDSPLPVTTM 328
           AVSQAPSPESNP+SP PV TM
Sbjct: 52  AVSQAPSPESNPNSPSPVVTM 72


>SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 180

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 17/39 (43%), Positives = 23/39 (58%)
 Frame = +3

Query: 507 LNILTRNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAF 623
           ++++ R +WRASL            Y K+VAVKKLVV F
Sbjct: 56  MHLVIRIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGF 94


>SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 337

 Score = 35.1 bits (77), Expect = 0.047
 Identities = 15/17 (88%), Positives = 16/17 (94%)
 Frame = -1

Query: 389 PFLRLPLRNRTLIPRYP 339
           PFLRLPLRNRTLI R+P
Sbjct: 224 PFLRLPLRNRTLILRHP 240


>SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 17/34 (50%), Positives = 19/34 (55%)
 Frame = +3

Query: 522 RNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAF 623
           R +WRASL            Y K+VAVKKLVV F
Sbjct: 14  RIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGF 47


>SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5)
          Length = 203

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 10/25 (40%), Positives = 12/25 (48%)
 Frame = -1

Query: 620 CNYELFNRNNFSIRYWSWNYRGCWH 546
           C   +  RN   +RYW W  R C H
Sbjct: 91  CEVTVIARNILPVRYWIWLSRKCGH 115


>SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0)
          Length = 441

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -3

Query: 408 PSLDVVAVSQAPSPESNPDSPLP 340
           P+ DV+A  Q P P S  D PLP
Sbjct: 75  PAEDVMAAHQEPKPTSAIDQPLP 97


>SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 15/30 (50%), Positives = 16/30 (53%)
 Frame = +3

Query: 534 RASLXXXXXXXXXXXXYTKIVAVKKLVVAF 623
           RASL            Y K+VAVKKLVV F
Sbjct: 5   RASLVPAAAVIPAPIAYIKVVAVKKLVVGF 34


>SB_55246| Best HMM Match : DUF1168 (HMM E-Value=0.32)
          Length = 943

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 2/35 (5%)
 Frame = +1

Query: 400 QGRQQARK--LPTPGTGGSDEK*RYGTLTRPRNRN 498
           QGR + RK  L  PG GGSD K R     +   RN
Sbjct: 136 QGRDEVRKAILDIPGEGGSDMKSRLQREVQEARRN 170


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,189,755
Number of Sequences: 59808
Number of extensions: 410990
Number of successful extensions: 1062
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 972
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1062
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1572561250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).