SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0076
         (634 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6)             61   6e-10
SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_12129| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   3e-09
SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   4e-09
SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   4e-09
SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   6e-09
SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.)               58   8e-09
SB_6437| Best HMM Match : No HMM Matches (HMM E-Value=.)               58   8e-09
SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.)               58   8e-09
SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.)               58   8e-09
SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.)               58   8e-09
SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9)                   58   8e-09
SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_38049| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_34847| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_25093| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_19329| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_18891| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_17342| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_16538| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_14423| Best HMM Match : Attractin (HMM E-Value=7)                   58   8e-09
SB_11715| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_9762| Best HMM Match : No HMM Matches (HMM E-Value=.)               58   8e-09
SB_9131| Best HMM Match : No HMM Matches (HMM E-Value=.)               58   8e-09
SB_7799| Best HMM Match : No HMM Matches (HMM E-Value=.)               58   8e-09
SB_3610| Best HMM Match : No HMM Matches (HMM E-Value=.)               58   8e-09
SB_2425| Best HMM Match : No HMM Matches (HMM E-Value=.)               58   8e-09
SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   2e-08
SB_6616| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   2e-08
SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_56484| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_51655| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_48354| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_40967| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_37958| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_33457| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_32499| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_22792| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_22308| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_21073| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_8430| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_7764| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_7252| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_6890| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_6254| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_5934| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_4384| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_4226| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_3933| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_2287| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_2174| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_1281| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_1196| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_548| Best HMM Match : No HMM Matches (HMM E-Value=.)                56   3e-08
SB_59001| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_56111| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_55672| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_55664| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_53956| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_53249| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_51510| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_51154| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_50695| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_48941| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_48813| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_48226| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_46383| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_46329| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_44053| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_44030| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_43619| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_40150| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_39869| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_37993| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_37658| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_36882| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_36717| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_36525| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_34440| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_34378| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_33989| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_33474| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_33328| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_32275| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_32014| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_27489| Best HMM Match : Pep_M12B_propep (HMM E-Value=4.7)           56   3e-08
SB_24551| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_23617| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_22358| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_22112| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_21571| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_20387| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_18631| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_18144| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_16489| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_16392| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_15984| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_14392| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_13789| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_12309| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_12306| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_12167| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_10889| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_9487| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_8117| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_7322| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_6918| Best HMM Match : Attractin (HMM E-Value=7)                    56   3e-08
SB_6386| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_5743| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_3955| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_2453| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_2080| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_138| Best HMM Match : No HMM Matches (HMM E-Value=.)                56   3e-08
SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_56722| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_56542| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_56050| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_54550| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_53318| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9)           55   6e-08
SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_53107| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9)           55   6e-08
SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_49414| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_48014| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_46716| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_44048| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_43745| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_43288| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_43021| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_42472| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_41544| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_38493| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_37636| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_36504| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_36156| Best HMM Match : Attractin (HMM E-Value=7)                   55   6e-08
SB_36137| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.8)           55   6e-08
SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_34993| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_34853| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_32221| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_30769| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4)           55   6e-08
SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_27143| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_25145| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_22505| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_21431| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6)             55   6e-08
SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1)               55   6e-08
SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_19514| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_18889| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_18095| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_17546| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_16836| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_16782| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_16534| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_9127| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_9120| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_8797| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_8779| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_8654| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_8464| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_8410| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_8220| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_7356| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_7297| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_7249| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_7157| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_7113| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_7085| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_6037| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_5529| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_5295| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_5042| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_4578| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_4511| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_4433| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_4372| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_4161| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_3964| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_3637| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_3280| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_2782| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_2639| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_2564| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_2150| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_1538| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_1504| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_788| Best HMM Match : No HMM Matches (HMM E-Value=.)                55   6e-08
SB_721| Best HMM Match : No HMM Matches (HMM E-Value=.)                55   6e-08
SB_574| Best HMM Match : PapG_N (HMM E-Value=8)                        55   6e-08
SB_172| Best HMM Match : No HMM Matches (HMM E-Value=.)                55   6e-08
SB_59785| Best HMM Match : TBCA (HMM E-Value=3)                        55   6e-08
SB_59546| Best HMM Match : Collagen (HMM E-Value=0.003)                55   6e-08
SB_59242| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_59187| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_58964| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_58933| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_58264| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_57917| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_57878| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_57788| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_57063| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_56857| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_56195| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_56114| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9)           55   6e-08
SB_56094| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_55984| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_55844| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_55372| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_55221| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_54670| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_54625| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_54410| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_54192| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_53924| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_53701| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_53637| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_53434| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_52930| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_52839| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_52708| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_52332| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_52026| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_51920| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_51767| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_51579| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_50997| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_50914| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_50534| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_50427| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_50404| Best HMM Match : Pep_M12B_propep (HMM E-Value=6)             55   6e-08
SB_50393| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_50189| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_49781| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_49101| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_49042| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_48963| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_48957| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_48453| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_47917| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_47857| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_47720| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_47666| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_47427| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_47350| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_46769| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_46630| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_46320| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_46081| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_45834| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_45450| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_45197| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_45018| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_44709| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_44372| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_44370| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9)           55   6e-08
SB_44174| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_43572| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_42784| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_42209| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_41701| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_41333| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_41310| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_41098| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_41064| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_40781| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_40467| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_40329| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_40121| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_40085| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_39718| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_39341| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_38278| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_38181| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_37765| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_37564| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_37287| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_37073| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_36965| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_36869| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_36786| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_36725| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08

>SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6)
          Length = 149

 Score = 61.3 bits (142), Expect = 6e-10
 Identities = 29/44 (65%), Positives = 32/44 (72%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSVSNRITR 490
           F PF   E+SVL EL LGHLRY LTDVPPQ NSP GSV +  +R
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSPPGSVFDTESR 106


>SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 28/41 (68%), Positives = 30/41 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSVSNR 499
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV +R
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDR 116


>SB_12129| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF P E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 63  FYPFVPHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 100


>SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 30/47 (63%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRSARE 122


>SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 30/47 (63%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDTDRSARE 122


>SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NSP  SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSPPDSV 113


>SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 100


>SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 100


>SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_6437| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 100


>SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9)
          Length = 276

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 100


>SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 115 FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 152


>SB_38049| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 100


>SB_34847| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 100


>SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 115 FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 152


>SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_25093| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_19329| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 100


>SB_18891| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_17342| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 100


>SB_16538| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 100


>SB_14423| Best HMM Match : Attractin (HMM E-Value=7)
          Length = 162

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 114 FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 151


>SB_11715| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_9762| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_9131| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_7799| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_3610| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_2425| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS  GSV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPGSV 113


>SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 27/38 (71%), Positives = 28/38 (73%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF  RE+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLREISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R T+E
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSTKE 122


>SB_6616| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 27/41 (65%), Positives = 29/41 (70%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSVSNR 499
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV +R
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDR 116


>SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_56484| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 109


>SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_51655| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 109


>SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_48354| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 109


>SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_40967| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 109


>SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_37958| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 109


>SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_33457| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 109


>SB_32499| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_22792| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 153

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 105 FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 151


>SB_22308| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 77  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 123


>SB_21073| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 109


>SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_8430| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_7764| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_7252| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_6890| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_6254| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_5934| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_4384| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 109


>SB_4226| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_3933| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 77  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 123


>SB_2287| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 77  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 123


>SB_2174| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_1281| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_1196| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_548| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_59001| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_56111| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_55672| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_55664| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_53956| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_53249| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_51510| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_51154| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_50695| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 109


>SB_48941| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHL Y LTDVPPQ NS  GSV
Sbjct: 63  FYPFVLHEISVLIELTLGHLHYRLTDVPPQPNSQPGSV 100


>SB_48813| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_48226| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_46383| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 109


>SB_46329| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_44053| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_44030| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 109


>SB_43619| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_40150| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_39869| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_37993| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_37658| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_36882| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_36717| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_36525| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_34440| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_34378| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_33989| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_33474| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_33328| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_32275| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_32014| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_27489| Best HMM Match : Pep_M12B_propep (HMM E-Value=4.7)
          Length = 139

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_24551| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_23617| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_22358| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_22112| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_21571| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_20387| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_18631| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 109


>SB_18144| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_16489| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_16392| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_15984| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_14392| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_13789| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_12309| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_12306| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_12167| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 109


>SB_10889| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_9487| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_8117| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_7322| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_6918| Best HMM Match : Attractin (HMM E-Value=7)
          Length = 163

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 115 FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 161


>SB_6386| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_5743| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_3955| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_2453| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_2080| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_138| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 29/47 (61%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV--SNRITRE 487
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV  ++R  RE
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRSARE 122


>SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 77  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 114


>SB_56722| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 100


>SB_56542| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 100


>SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_56050| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 100


>SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_54550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_53318| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9)
          Length = 120

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 100


>SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_53107| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9)
          Length = 120

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 100


>SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_49414| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 100


>SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 114 FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 151


>SB_48014| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_46716| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 100


>SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 115 FFPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 152


>SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_44048| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 100


>SB_43745| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 100


>SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_43288| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 100


>SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_43021| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 77  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 114


>SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_42472| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 100


>SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 76  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 113


>SB_41544| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 26/38 (68%), Positives = 27/38 (71%)
 Frame = -2

Query: 621 FCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPHGSV 508
           F PF   E+SVL EL LGHLRY LTDVPPQ NS   SV
Sbjct: 63  FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSV 100


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,065,985
Number of Sequences: 59808
Number of extensions: 413279
Number of successful extensions: 1549
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 1479
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1547
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1584657875
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).