SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0071
         (637 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   9e-07
SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   3e-05
SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   6e-05
SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   6e-05
SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   6e-05
SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   6e-05
SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   6e-05
SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.)               45   6e-05
SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.)               45   6e-05
SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.)               45   6e-05
SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.)               45   6e-05
SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.)               45   6e-05
SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2)                 45   6e-05
SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   6e-05
SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   6e-05
SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   6e-05
SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   6e-05
SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   6e-05
SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   6e-05
SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   8e-05
SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   1e-04
SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.)                44   1e-04
SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.)               38   0.005
SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.036
SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.19 
SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.26 
SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041)                   31   0.78 
SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.0  
SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1)               30   1.4  
SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)               29   4.2  
SB_47253| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_40022| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_28768| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_17596| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_15711| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_13940| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_3184| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   4.2  
SB_57385| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_54119| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_52963| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_50350| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_34064| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_31920| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_28366| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8)                    29   4.2  
SB_25308| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_24745| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_2618| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   4.2  
SB_46879| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  
SB_41433| Best HMM Match : Neur_chan_LBD (HMM E-Value=4.6e-07)         27   9.7  

>SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 25/42 (59%), Positives = 29/42 (69%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGFIVRVSRSSHPFKV 169
           LN  FGSS  ASSAYQ WPT + H +SGF    SR+S+ FKV
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGFNY-ASRTSYQFKV 57


>SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 38

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 20/29 (68%), Positives = 21/29 (72%)
 Frame = +1

Query: 355 NRYGPPSGFPLTST*PGIVHHLSGPSICA 441
           NRY PP  FPL S   GIVHHLSGP+ CA
Sbjct: 1   NRYEPPPEFPLASPYSGIVHHLSGPNRCA 29


>SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 86

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 57  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 85


>SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 83

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 54  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 82


>SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 84

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 55  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 83


>SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 84

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 55  LNRAFGSSRIASSAYQKWPTSNSHSLSGF 83


>SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTKNSHSLSGF 45


>SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 54

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2)
          Length = 125

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 96  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 124


>SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 168

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 139 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 167


>SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNHAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 112

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 33/88 (37%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = +3

Query: 354 ESLRSSIRVSPDFDLTRHSSPSFGSQHLCSERAFIH*LETRRLGSAKSRT-XXXXXXXXX 530
           ESLR+S RVS  F L RHSSPSFGSQ +   R++ + L   R+G +  R           
Sbjct: 35  ESLRASTRVSSGFTLFRHSSPSFGSQQM---RSYSN-LSKSRIGRSMMRLFFVEKGSHLS 90

Query: 531 ERRAFAFTFVTPFSLMLKIYKTHDSHTC 614
           +R    F + + F  +       DSHTC
Sbjct: 91  DRSRLHFHYASEFRSL------KDSHTC 112


>SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 18/29 (62%), Positives = 21/29 (72%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  +GSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAYGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 103

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSA Q WPT + H +SGF
Sbjct: 74  LNRAFGSSRIASSALQKWPTRNSHSLSGF 102


>SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQISGF 130
           LN  FGSS  ASSAYQ  PT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKGPTRNSHSLSGF 45


>SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 16/26 (61%), Positives = 18/26 (69%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPTWHRHQI 121
           LN  FGSS  ASSAYQ WPT + H +
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSL 42


>SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 15/20 (75%), Positives = 15/20 (75%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWPT 103
           LN  FGSS  ASSAYQ WPT
Sbjct: 17  LNRAFGSSRIASSAYQKWPT 36


>SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 91

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 14/21 (66%), Positives = 14/21 (66%)
 Frame = +1

Query: 355 NRYGPPSGFPLTST*PGIVHH 417
           NRY PP  FPL S   GIVHH
Sbjct: 1   NRYEPPPEFPLASPYSGIVHH 21


>SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 178

 Score = 32.7 bits (71), Expect = 0.26
 Identities = 15/17 (88%), Positives = 15/17 (88%)
 Frame = +2

Query: 305 ISLSPLYPVPTIDLHVR 355
           ISLSPLYP  TIDLHVR
Sbjct: 38  ISLSPLYPNLTIDLHVR 54


>SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041)
          Length = 128

 Score = 31.1 bits (67), Expect = 0.78
 Identities = 18/68 (26%), Positives = 37/68 (54%), Gaps = 4/68 (5%)
 Frame = -1

Query: 529 LREDEIISYVRDFALPRRLVSNQ*MKARSEHKC----WDPKDGELCLVRSKSGETLMEDR 362
           L +  + S      L RR VSN   + +++H+     +  +DG+   V++K G++L++  
Sbjct: 15  LSQQRLASRASASILARRYVSNGKEQTKAKHETVSITFVDRDGDRQTVKAKVGDSLLDVA 74

Query: 361 SDSDVQID 338
            D+DV ++
Sbjct: 75  KDNDVDLE 82


>SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 54

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 14/19 (73%), Positives = 14/19 (73%)
 Frame = +2

Query: 44  LNTTFGSSHSASSAYQNWP 100
           LN  FGSS  ASSAYQN P
Sbjct: 17  LNRAFGSSRIASSAYQNGP 35



 Score = 28.3 bits (60), Expect = 5.5
 Identities = 18/43 (41%), Positives = 20/43 (46%)
 Frame = +3

Query: 3   PTPFMVSHERFLGALTLRLVHPTAPVLLTKIGPLGTVIRSPAS 131
           PTPF+ S ER L  L              + GPLGT I  PAS
Sbjct: 3   PTPFVGSDERRLWHLNRAFGSSRIASSAYQNGPLGTRIHCPAS 45


>SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1)
          Length = 276

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 15/25 (60%), Positives = 15/25 (60%)
 Frame = +2

Query: 56  FGSSHSASSAYQNWPTWHRHQISGF 130
           FGSS  ASS YQN PT  R    GF
Sbjct: 78  FGSSRIASSGYQNGPTRTRIHCPGF 102



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 7/66 (10%)
 Frame = +3

Query: 3   PTPFMVSHERFLGALTLRLVHPTAPVLLTKI-------GPLGTVIRSPASSFE*AGVLTH 161
           PTPF+ S ER       RL HP      ++I       GP  T I  P  + +  G+LT+
Sbjct: 60  PTPFVGSDER-------RLWHPYRAFGSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLLTN 111

Query: 162 LKFENR 179
           LKFENR
Sbjct: 112 LKFENR 117


>SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4)
          Length = 402

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 261 TRTHVRLLGPCF 272


>SB_47253| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_40022| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_28768| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_17596| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_15711| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_13940| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_3184| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_57385| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_54119| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_52963| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_50350| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 183

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 292

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 155 TRTHVRLLGPCF 166


>SB_34064| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 425

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 355 TRTHVRLLGPCF 366


>SB_31920| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_28366| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8)
          Length = 411

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 274 TRTHVRLLGPCF 285


>SB_25308| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_24745| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_2618| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 10/12 (83%), Positives = 11/12 (91%)
 Frame = +1

Query: 601 TRTHARLLGPCY 636
           TRTH RLLGPC+
Sbjct: 31  TRTHVRLLGPCF 42


>SB_46879| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 314

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/68 (23%), Positives = 32/68 (47%), Gaps = 1/68 (1%)
 Frame = -1

Query: 586 IFNIKLKGVTKVKANARRSLREDEIISYVRDFALPRRL-VSNQ*MKARSEHKCWDPKDGE 410
           +F   L G        R  L++D    +   F  PR   +S++ + +  +++CW    GE
Sbjct: 172 LFGSHLLGERLFSMTGRNVLQQDGSTDFNCTFCKPRIYDISSEALTSVPKYRCWKYIGGE 231

Query: 409 LCLVRSKS 386
           +  +R+K+
Sbjct: 232 IAELRAKA 239


>SB_41433| Best HMM Match : Neur_chan_LBD (HMM E-Value=4.6e-07)
          Length = 175

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = +3

Query: 33  FLGALTLRLVHPTAPVLLTKIGPLGTV 113
           FL A T ++ H T P  +T I P+G V
Sbjct: 144 FLNAKTAKMHHVTTPNQMTLIAPMGVV 170


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,117,674
Number of Sequences: 59808
Number of extensions: 427074
Number of successful extensions: 985
Number of sequences better than 10.0: 53
Number of HSP's better than 10.0 without gapping: 869
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 985
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1596754500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).