SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0055
         (465 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_43930| Best HMM Match : ANF_receptor (HMM E-Value=0)                27   5.8  
SB_42361| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.8  
SB_16010| Best HMM Match : Ribosomal_L6e_N (HMM E-Value=1.9)           27   7.7  

>SB_43930| Best HMM Match : ANF_receptor (HMM E-Value=0)
          Length = 915

 Score = 27.5 bits (58), Expect = 5.8
 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 2/62 (3%)
 Frame = -1

Query: 240 LNDRRGPKMNFGLISWT*LKTSALLNCR--SLMLGNTAVNVRVP*STSNASLLTIGSLAF 67
           + DR+G  +N+  I+W      AL   R  S ML N  +   +  S +  S     SL F
Sbjct: 55  VGDRKGSDLNYYAITWVEAMLYALNEIRHNSSMLQNYTLGFDIRDSCNKVSTALEASLDF 114

Query: 66  LL 61
           LL
Sbjct: 115 LL 116


>SB_42361| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 286

 Score = 27.5 bits (58), Expect = 5.8
 Identities = 14/30 (46%), Positives = 20/30 (66%)
 Frame = -1

Query: 345 ITGH*NSSLRFKYFLKTNRDVVQQLA*LTL 256
           +T H N   R++  LKTN + V+Q+A LTL
Sbjct: 122 LTMHTNLMKRYQKELKTNTEQVEQIATLTL 151


>SB_16010| Best HMM Match : Ribosomal_L6e_N (HMM E-Value=1.9)
          Length = 251

 Score = 27.1 bits (57), Expect = 7.7
 Identities = 12/41 (29%), Positives = 20/41 (48%)
 Frame = +2

Query: 44  KTIFKYNRKAKEPIVRSDALEVDYGTLTFTAVFPSISDLQL 166
           K +F+Y RK +E     +    +Y T  FT   PS+  + +
Sbjct: 136 KAVFEYLRKRQERRDLFEGYNKEYDTFAFTTKIPSLLHISI 176


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,253,283
Number of Sequences: 59808
Number of extensions: 180920
Number of successful extensions: 427
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 420
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 427
length of database: 16,821,457
effective HSP length: 76
effective length of database: 12,276,049
effective search space used: 957531822
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).