SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0038
         (703 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.)               86   2e-17
SB_30216| Best HMM Match : TIL (HMM E-Value=3.1)                       85   7e-17
SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.)              85   7e-17
SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.)              69   3e-12
SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.)               65   5e-11
SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.)              65   6e-11
SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.)              65   6e-11
SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   1e-10
SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.)               64   1e-10
SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   1e-10
SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2)                   63   2e-10
SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.)              53   2e-07
SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   3e-06
SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   6e-06
SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59)             48   1e-05
SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.)               45   7e-05
SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.)               45   7e-05
SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.)               45   7e-05
SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.)               45   7e-05
SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.)               45   7e-05
SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2)                 45   7e-05
SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.)                44   2e-04
SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5)                42   5e-04
SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.001
SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.)               38   0.006
SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1)               36   0.032
SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.042
SB_18772| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.13 
SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.2  
SB_50854| Best HMM Match : ig (HMM E-Value=6.1e-27)                    30   2.1  
SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.6  
SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0)                    29   3.6  
SB_25485| Best HMM Match : ICln_channel (HMM E-Value=0.77)             28   6.4  
SB_56448| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  
SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   8.4  

>SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 182

 Score = 86.2 bits (204), Expect = 2e-17
 Identities = 56/112 (50%), Positives = 63/112 (56%), Gaps = 1/112 (0%)
 Frame = -3

Query: 335 TAGRWPWKSESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RV-G 159
           TAGRWPWK ESAKEC TTHLPKQ ALK    +       + A   L          RV G
Sbjct: 80  TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGG 130

Query: 158 RARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSSCSRVS 3
           R  R A  G  +    +S  ADLGGSSKYS+E+ ED  GE F VNSS + VS
Sbjct: 131 RGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSSWTWVS 180


>SB_30216| Best HMM Match : TIL (HMM E-Value=3.1)
          Length = 212

 Score = 84.6 bits (200), Expect = 7e-17
 Identities = 54/107 (50%), Positives = 60/107 (56%), Gaps = 1/107 (0%)
 Frame = -3

Query: 335 TAGRWPWKSESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RV-G 159
           TAGRWPWK ESAKEC TTHLPKQ ALK    +       + A   L          RV G
Sbjct: 1   TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGG 51

Query: 158 RARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
           R  R A  G  +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 52  RGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 96


>SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 295

 Score = 84.6 bits (200), Expect = 7e-17
 Identities = 54/107 (50%), Positives = 60/107 (56%), Gaps = 1/107 (0%)
 Frame = -3

Query: 335 TAGRWPWKSESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RV-G 159
           TAGRWPWK ESAKEC TTHLPKQ ALK    +       + A   L          RV G
Sbjct: 1   TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGG 51

Query: 158 RARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
           R  R A  G  +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 52  RGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 96


>SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 69.3 bits (162), Expect = 3e-12
 Identities = 50/107 (46%), Positives = 57/107 (53%), Gaps = 1/107 (0%)
 Frame = -3

Query: 335 TAGRWPWKSESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG- 159
           TAGR   + ESAKEC TTHLPKQ ALK    +       + A   L          RVG 
Sbjct: 1   TAGRVAMEVESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGG 51

Query: 158 RARRRAQKGLGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
           R  R A  G  +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 52  RGGRDAASGASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 96


>SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 97

 Score = 65.3 bits (152), Expect = 5e-11
 Identities = 48/103 (46%), Positives = 55/103 (53%), Gaps = 1/103 (0%)
 Frame = -3

Query: 308 ESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKG 132
           ESAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G
Sbjct: 4   ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASG 54

Query: 131 LGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSSCSRVS 3
             +    +S  ADLGGSSKYS+E+ ED  GE F VNSS + VS
Sbjct: 55  ASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSSWTWVS 95


>SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 93

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 47/100 (47%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = -3

Query: 314 KSESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQ 138
           K ESAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A 
Sbjct: 2   KLESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAA 52

Query: 137 KGLGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
            G  +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 53  SGASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 90


>SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 93

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 47/100 (47%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = -3

Query: 314 KSESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQ 138
           K ESAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A 
Sbjct: 2   KLESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAA 52

Query: 137 KGLGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
            G  +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 53  SGASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 90


>SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 93

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 46/98 (46%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = -3

Query: 308 ESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKG 132
           ESAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G
Sbjct: 4   ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASG 54

Query: 131 LGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
             +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 55  ASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 90


>SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 93

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 46/98 (46%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = -3

Query: 308 ESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKG 132
           ESAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G
Sbjct: 4   ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASG 54

Query: 131 LGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
             +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 55  ASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 90


>SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 93

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 46/98 (46%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = -3

Query: 308 ESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKG 132
           ESAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G
Sbjct: 4   ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASG 54

Query: 131 LGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
             +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 55  ASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 90


>SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 93

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 46/98 (46%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = -3

Query: 308 ESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKG 132
           ESAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G
Sbjct: 4   ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASG 54

Query: 131 LGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
             +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 55  ASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 90


>SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 93

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 46/98 (46%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = -3

Query: 308 ESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKG 132
           ESAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G
Sbjct: 4   ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASG 54

Query: 131 LGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
             +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 55  ASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 90


>SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 93

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 46/98 (46%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = -3

Query: 308 ESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKG 132
           ESAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G
Sbjct: 4   ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASG 54

Query: 131 LGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
             +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 55  ASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 90


>SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 93

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 46/98 (46%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = -3

Query: 308 ESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKG 132
           ESAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G
Sbjct: 4   ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASG 54

Query: 131 LGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
             +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 55  ASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 90


>SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 93

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 46/98 (46%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = -3

Query: 308 ESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKG 132
           ESAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G
Sbjct: 4   ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASG 54

Query: 131 LGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
             +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 55  ASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 90


>SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 46/98 (46%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = -3

Query: 308 ESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKG 132
           ESAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G
Sbjct: 10  ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASG 60

Query: 131 LGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
             +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 61  ASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 96


>SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2)
          Length = 93

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 46/98 (46%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = -3

Query: 308 ESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKG 132
           ESAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G
Sbjct: 4   ESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGVRDAASG 54

Query: 131 LGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
             +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 55  ASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 90


>SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 93

 Score = 61.7 bits (143), Expect = 6e-10
 Identities = 45/97 (46%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = -3

Query: 305 SAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKGL 129
           SAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G 
Sbjct: 5   SAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASGA 55

Query: 128 GVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
            +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 56  SLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 90


>SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 100

 Score = 61.7 bits (143), Expect = 6e-10
 Identities = 46/100 (46%), Positives = 52/100 (52%), Gaps = 1/100 (1%)
 Frame = -3

Query: 314 KSESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVGRAR-RRAQ 138
           K ESAKEC TTHLPKQ ALK    +       + A   L          RVG    R A 
Sbjct: 9   KLESAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGLGVRDAA 59

Query: 137 KGLGVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
            G  +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 60  SGASLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 97


>SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 93

 Score = 61.7 bits (143), Expect = 6e-10
 Identities = 45/97 (46%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = -3

Query: 305 SAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKGL 129
           SAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G 
Sbjct: 5   SAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASGA 55

Query: 128 GVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
            +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 56  SLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 90


>SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 93

 Score = 61.7 bits (143), Expect = 6e-10
 Identities = 45/97 (46%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = -3

Query: 305 SAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKGL 129
           SAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G 
Sbjct: 5   SAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASGA 55

Query: 128 GVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
            +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 56  SLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 90


>SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 93

 Score = 61.7 bits (143), Expect = 6e-10
 Identities = 45/97 (46%), Positives = 51/97 (52%), Gaps = 1/97 (1%)
 Frame = -3

Query: 305 SAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKGL 129
           SAKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G 
Sbjct: 5   SAKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASGA 55

Query: 128 GVSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
            +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 56  SLGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 90


>SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 44/96 (45%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = -3

Query: 302 AKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKGLG 126
           AKEC TTHLPKQ ALK    +       + A   L          RVG R  R A  G  
Sbjct: 39  AKECVTTHLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASGAS 89

Query: 125 VSPLGASVGADLGGSSKYSSEALED*RGEGFRVNSS 18
           +    +S  ADLGGSSKYS+E+ ED  GE F VNSS
Sbjct: 90  LGETASS--ADLGGSSKYSNESFEDRSGERFHVNSS 123



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 18/32 (56%), Positives = 22/32 (68%)
 Frame = -1

Query: 391 VKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 296
           ++   +RS D  KGVG S QQDGGHGS NP +
Sbjct: 9   LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPAK 40


>SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 44/100 (44%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
 Frame = -3

Query: 299 KECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF*FGIIKP*RVG-RARRRAQKGLGV 123
           KEC TT LPKQ ALK    +       + A   L          RVG R  R A  G  +
Sbjct: 40  KECVTTPLPKQLALKMDGAQASHLYRAVGADAKLR---------RVGGRGGRDAASGASL 90

Query: 122 SPLGASVGADLGGSSKYSSEALED*RGEGFRVNSSCSRVS 3
               +S  ADLGGSSKYS+E+ ED  GE F VNSS + VS
Sbjct: 91  GETASS--ADLGGSSKYSNESFEDRSGERFHVNSSWTWVS 128



 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 19/32 (59%), Positives = 23/32 (71%)
 Frame = -1

Query: 391 VKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 296
           ++   +RS D  KGVG S QQDGGHGS NPL+
Sbjct: 9   LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLK 40


>SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 42

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 25/32 (78%), Positives = 26/32 (81%)
 Frame = -3

Query: 314 KSESAKECATTHLPKQPALKWMALKRFAYTLP 219
           K ESAKEC TTHLPKQ ALK MALKR  YT+P
Sbjct: 2   KVESAKECVTTHLPKQLALKMMALKRRTYTVP 33


>SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 172

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 28/58 (48%), Positives = 37/58 (63%)
 Frame = +3

Query: 3   TDSRATTVHAKPFSTSVLQGLAGVFATTTKICTDGGSKRAHAQTLLRSPSRTSYSLRL 176
           T+   T VH +PFSTSV + L  +FATTTKICT G   +A A+  + +P+  SYS  L
Sbjct: 108 TNPCPTAVHMEPFSTSVFKALIRIFATTTKICTGGRFTQARARGCVTTPT-PSYSSEL 164


>SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 24/41 (58%), Positives = 28/41 (68%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGFIVRVSRSSHPFK 508
           LN  FGSS  ASSAYQ WPT + H +SGF    SR+S+ FK
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGFNY-ASRTSYQFK 56


>SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 24/33 (72%), Positives = 26/33 (78%)
 Frame = +1

Query: 1   RLTREQLLFTRNPSPRQSSRASLEYLLLPPRSA 99
           RLT  QLLFT N SP +SS+ S EYLLLPPRSA
Sbjct: 90  RLTHVQLLFTWNLSPLRSSKLSFEYLLLPPRSA 122


>SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59)
          Length = 1060

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 23/37 (62%), Positives = 26/37 (70%)
 Frame = -1

Query: 391 VKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 281
           ++   +RS D  KGVG S QQDGGHGS NPLR  QRL
Sbjct: 9   LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLRKGQRL 45


>SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 86

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 57  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 85



 Score = 25.0 bits (52), Expect(2) = 9.5
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +3

Query: 228 IGKTLQRHPFQG 263
           IG TL+RHPF G
Sbjct: 24  IGATLERHPFSG 35



 Score = 21.4 bits (43), Expect(2) = 9.5
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = +3

Query: 339 ERPTPFMVSHERFL 380
           E+PTPF+ S ER L
Sbjct: 41  EQPTPFVGSDERRL 54


>SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 83

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 54  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 82


>SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 84

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 55  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 83


>SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 84

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 55  LNRAFGSSRIASSAYQKWPTSNSHSLSGF 83



 Score = 25.0 bits (52), Expect(2) = 9.9
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +3

Query: 228 IGKTLQRHPFQG 263
           IG TL+RHPF G
Sbjct: 22  IGATLERHPFSG 33



 Score = 21.4 bits (43), Expect(2) = 9.9
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = +3

Query: 339 ERPTPFMVSHERFL 380
           E+PTPF+ S ER L
Sbjct: 39  EQPTPFVGSDERRL 52


>SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTKNSHSLSGF 45


>SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 54

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2)
          Length = 125

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 96  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 124


>SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 168

 Score = 44.8 bits (101), Expect = 7e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 139 LNRAFGSSRIASSAYQKWPTRNSHSLSGF 167


>SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 19/29 (65%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNHAFGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 18/29 (62%), Positives = 21/29 (72%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  +GSS  ASSAYQ WPT + H +SGF
Sbjct: 17  LNRAYGSSRIASSAYQKWPTRNSHSLSGF 45


>SB_18857| Best HMM Match : Gln-synt_N (HMM E-Value=1.5)
          Length = 164

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 21/50 (42%), Positives = 28/50 (56%)
 Frame = +3

Query: 3   TDSRATTVHAKPFSTSVLQGLAGVFATTTKICTDGGSKRAHAQTLLRSPS 152
           T+   T VH  PFSTS  Q L  +FATTTKIC  G   +   +  + +P+
Sbjct: 43  TNPCPTAVHMDPFSTSGFQALILIFATTTKICPGGRFTQGSGKGWVTTPT 92


>SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 103

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSA Q WPT + H +SGF
Sbjct: 74  LNRAFGSSRIASSALQKWPTRNSHSLSGF 102


>SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 33

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 20/25 (80%), Positives = 21/25 (84%)
 Frame = -2

Query: 375 NAHGTP*KALVAHDSRTVAMEVGIR 301
           +AH TP K LVA DSRTVAMEVGIR
Sbjct: 9   DAHQTPQKVLVALDSRTVAMEVGIR 33


>SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQISGF 472
           LN  FGSS  ASSAYQ  PT + H +SGF
Sbjct: 17  LNRAFGSSRIASSAYQKGPTRNSHSLSGF 45


>SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 16/26 (61%), Positives = 18/26 (69%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPTWHRHQI 463
           LN  FGSS  ASSAYQ WPT + H +
Sbjct: 17  LNRAFGSSRIASSAYQKWPTRNSHSL 42


>SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1)
          Length = 276

 Score = 35.9 bits (79), Expect = 0.032
 Identities = 21/41 (51%), Positives = 24/41 (58%)
 Frame = +2

Query: 398 FGSSHSASSAYQNWPTWHRHQISGFIVRVSRSSHPFKFENR 520
           FGSS  ASS YQN PT  R    GF  +V   ++  KFENR
Sbjct: 78  FGSSRIASSGYQNGPTRTRIHCPGFNKQVGLLTN-LKFENR 117


>SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 35.5 bits (78), Expect = 0.042
 Identities = 15/20 (75%), Positives = 15/20 (75%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWPT 445
           LN  FGSS  ASSAYQ WPT
Sbjct: 17  LNRAFGSSRIASSAYQKWPT 36


>SB_18772| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 64

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 17/29 (58%), Positives = 21/29 (72%)
 Frame = -1

Query: 121 ARLEPPSVQILVVVANTPARPWRTDVEKG 35
           A ++ P VQILVVVAN   R  +T+VEKG
Sbjct: 34  AWVKRPPVQILVVVANIQMRALKTEVEKG 62


>SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 54

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 14/19 (73%), Positives = 14/19 (73%)
 Frame = +2

Query: 386 LNTTFGSSHSASSAYQNWP 442
           LN  FGSS  ASSAYQN P
Sbjct: 17  LNRAFGSSRIASSAYQNGP 35



 Score = 28.7 bits (61), Expect = 4.8
 Identities = 18/44 (40%), Positives = 21/44 (47%)
 Frame = +3

Query: 342 RPTPFMVSHERFLGALTLRLVHPTAPVLLTKIGPLGTVIRSPAS 473
           +PTPF+ S ER L  L              + GPLGT I  PAS
Sbjct: 2   QPTPFVGSDERRLWHLNRAFGSSRIASSAYQNGPLGTRIHCPAS 45


>SB_50854| Best HMM Match : ig (HMM E-Value=6.1e-27)
          Length = 770

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 20/51 (39%), Positives = 24/51 (47%)
 Frame = +3

Query: 27  HAKPFSTSVLQGLAGVFATTTKICTDGGSKRAHAQTLLRSPSRTSYSLRLN 179
           HA  F   V  GL G+ AT  +I T  GS R     ++  P RTS  L  N
Sbjct: 410 HATTFLVVVGHGLPGIQATRPRIKTTAGS-RCVLNCIVTLPPRTSVILSWN 459


>SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 607

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = -3

Query: 578 KQSHPVKRMIRGIGAETTSTYSQI*MGENSGLL 480
           +Q HPVK   RG+GA   +T S I +G  S  L
Sbjct: 443 EQLHPVKSSARGVGAVIAATSSVITVGTASSRL 475


>SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0)
          Length = 3369

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +1

Query: 283 VVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF 378
           +  H + ++DF G R A+M+D +L  C  S+F
Sbjct: 386 LTTHFMDEADFLGDRIAIMADGQLRCCGSSLF 417


>SB_25485| Best HMM Match : ICln_channel (HMM E-Value=0.77)
          Length = 673

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 13/46 (28%), Positives = 22/46 (47%)
 Frame = -3

Query: 329 GRWPWKSESAKECATTHLPKQPALKWMALKRFAYTLPLPARVMLNF 192
           GR+ W     ++C +    ++   K M  +RF   L L  R M++F
Sbjct: 283 GRFAWSQTECQDCVSLRTKRRLVNKVMEAERFGEELVLLKREMVSF 328


>SB_56448| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 12/17 (70%), Positives = 14/17 (82%)
 Frame = -3

Query: 92 LGGSSKYSSEALED*RG 42
          LGGSSKYS+E+ ED  G
Sbjct: 2  LGGSSKYSNESFEDRSG 18


>SB_6080| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2101

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 11/36 (30%), Positives = 18/36 (50%)
 Frame = -2

Query: 285 DSPAEATSPEMDGAEAFCLYTTVTGTCDAKFLIWYH 178
           +SP +  S     A   C    +TG C A+F+ W++
Sbjct: 609 ESPKKVRSAHKGHATQVCSLPKLTGPCMARFIRWHY 644


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,490,346
Number of Sequences: 59808
Number of extensions: 507884
Number of successful extensions: 2206
Number of sequences better than 10.0: 63
Number of HSP's better than 10.0 without gapping: 2027
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2205
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1841633001
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).