SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0032
         (636 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_37041| Best HMM Match : GBP (HMM E-Value=0)                        111   2e-27
SB_36132| Best HMM Match : GBP (HMM E-Value=8.7e-28)                   59   3e-09
SB_9615| Best HMM Match : GBP (HMM E-Value=2.8e-22)                    41   0.001
SB_9614| Best HMM Match : GBP (HMM E-Value=1e-31)                      40   0.001
SB_26857| Best HMM Match : Viral_NABP (HMM E-Value=2.6)                31   0.59 
SB_58520| Best HMM Match : RVT_1 (HMM E-Value=0.035)                   31   0.59 
SB_48376| Best HMM Match : HMG-CoA_red (HMM E-Value=6.8e-11)           31   0.59 
SB_51878| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.8  
SB_39021| Best HMM Match : M (HMM E-Value=5.3e-06)                     29   4.2  
SB_8432| Best HMM Match : IlvC (HMM E-Value=4)                         29   4.2  
SB_42147| Best HMM Match : Thioredoxin (HMM E-Value=0.3)               28   5.5  
SB_57708| Best HMM Match : Aldedh (HMM E-Value=0)                      28   7.3  
SB_7362| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   9.7  
SB_54374| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  

>SB_37041| Best HMM Match : GBP (HMM E-Value=0)
          Length = 466

 Score =  111 bits (267), Expect = 5e-25
 Identities = 48/70 (68%), Positives = 60/70 (85%)
 Frame = -1

Query: 507 LQGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFAL 328
           L+GFSWRGGSERDTTGILMW++ +     DGE+V ++L+DTQGAFDS STV+DCAT+FAL
Sbjct: 14  LEGFSWRGGSERDTTGILMWNKPYICKRPDGEEVVVLLMDTQGAFDSSSTVKDCATIFAL 73

Query: 327 STMLSSVQIY 298
           STM SS Q++
Sbjct: 74  STMTSSTQLF 83



 Score =  111 bits (266), Expect(2) = 2e-27
 Identities = 47/68 (69%), Positives = 54/68 (79%)
 Frame = -3

Query: 205 PFQRLQFLVRDWSFPYEAPYGADGGMQILSRRLKVSDKQHPELQSLRKHITACFSELACF 26
           PFQRL FLVRDWSFPYEA YG  GG QIL RRLK +++QH EL  +RKHI  CF ++ CF
Sbjct: 134 PFQRLLFLVRDWSFPYEANYGEAGGSQILERRLKTTERQHSELLQVRKHIKECFEKIGCF 193

Query: 25  LMPHPGLK 2
           LMPHPGL+
Sbjct: 194 LMPHPGLR 201



 Score = 29.5 bits (63), Expect(2) = 2e-27
 Identities = 12/19 (63%), Positives = 15/19 (78%)
 Frame = -3

Query: 253 LFTEYGRLALEDGGRTPFQ 197
           LFTEYG+LA+E+    PFQ
Sbjct: 82  LFTEYGKLAMENNEIKPFQ 100


>SB_36132| Best HMM Match : GBP (HMM E-Value=8.7e-28)
          Length = 368

 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 29/72 (40%), Positives = 45/72 (62%)
 Frame = -1

Query: 471 DTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALSTMLSSVQIYNL 292
           +T GI MW +  K  L DG++VA++ LDT+G   +  +    A VFA++T+LSS  IYN 
Sbjct: 154 ETMGIWMWGKPLKIKLQDGQEVALVFLDTEGFAATNVSESYDAKVFAVATLLSSYLIYNS 213

Query: 291 SQNIQEDDLQHL 256
            + I + D+ +L
Sbjct: 214 VKIIDQGDIDYL 225


>SB_9615| Best HMM Match : GBP (HMM E-Value=2.8e-22)
          Length = 621

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 2/79 (2%)
 Frame = -1

Query: 483 GSERD--TTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALSTMLSS 310
           G E D  T G+ +W    +   D G+   ++L+D++G   S+S  ++   +  L+ +LSS
Sbjct: 178 GDELDPKTMGLWLWVVPKQFRDDKGQPFTVVLVDSEGTKASQSQQKEDDVIVTLTLLLSS 237

Query: 309 VQIYNLSQNIQEDDLQHLH 253
           V IYN        DL+ L+
Sbjct: 238 VLIYNSEGVPTASDLEQLN 256


>SB_9614| Best HMM Match : GBP (HMM E-Value=1e-31)
          Length = 708

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 22/59 (37%), Positives = 35/59 (59%)
 Frame = -1

Query: 471 DTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALSTMLSSVQIYN 295
           +T GI ++    K    +G +V ++LLD++G   + +   D  +VF LS +LSSV IYN
Sbjct: 86  ETMGIWLYVVDQKFKDANGREVTVVLLDSEGINATGAQKSDDHSVFTLSVLLSSVMIYN 144


>SB_26857| Best HMM Match : Viral_NABP (HMM E-Value=2.6)
          Length = 526

 Score = 31.5 bits (68), Expect = 0.59
 Identities = 14/43 (32%), Positives = 27/43 (62%)
 Frame = -1

Query: 495 SWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDS 367
           +++ G   +T    + ++I +A +DDG+ V ++LLD   AFD+
Sbjct: 446 AYKKGHSTETALTRIQNDILRA-IDDGQSVILVLLDLSAAFDT 487


>SB_58520| Best HMM Match : RVT_1 (HMM E-Value=0.035)
          Length = 556

 Score = 31.5 bits (68), Expect = 0.59
 Identities = 14/43 (32%), Positives = 27/43 (62%)
 Frame = -1

Query: 495 SWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDS 367
           +++ G   +T    + ++I +A +DDG+ V ++LLD   AFD+
Sbjct: 367 AYKKGHSTETALTRIQNDILRA-IDDGQSVILVLLDLSAAFDT 408


>SB_48376| Best HMM Match : HMG-CoA_red (HMM E-Value=6.8e-11)
          Length = 135

 Score = 31.5 bits (68), Expect = 0.59
 Identities = 15/47 (31%), Positives = 28/47 (59%)
 Frame = -1

Query: 420 DGEKVAIILLDTQGAFDSESTVRDCATVFALSTMLSSVQIYNLSQNI 280
           DG++  + +  T+G   + ST R C+ +  L T +SS+   N+S+N+
Sbjct: 52  DGQQFFVPMATTEGCLVA-STNRGCSALMVLKTTVSSLSELNISKNL 97


>SB_51878| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +2

Query: 359 VDSLSKAPCVSSNIIATFSPSSSVALNISDHMSMPVVSLSEPPRQL 496
           VD L     + SN + + SPS ++A+ I   +S   V    PP Q+
Sbjct: 90  VDVLKNKFFLKSNALTSLSPSQAIAVLIRKLVSQKYVEFKTPPSQI 135


>SB_39021| Best HMM Match : M (HMM E-Value=5.3e-06)
          Length = 1691

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 7/53 (13%)
 Frame = -1

Query: 366 ESTVRDCATVFALSTMLSSVQIYN-------LSQNIQEDDLQHLHCSQSTVGW 229
           E TV++C+T  + STM    ++YN       +S N+++ + +   C+    G+
Sbjct: 835 ECTVKECSTDLSWSTMTDMERVYNEFLESKTISGNLRDVEFEDKECNTDQTGY 887


>SB_8432| Best HMM Match : IlvC (HMM E-Value=4)
          Length = 221

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 13/41 (31%), Positives = 25/41 (60%)
 Frame = -1

Query: 495 SWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAF 373
           +++ G   +T    + ++I +A +DDG+ V ++LLD   AF
Sbjct: 25  AYKKGHSTETALTRVQNDILRA-IDDGQSVILVLLDLSAAF 64


>SB_42147| Best HMM Match : Thioredoxin (HMM E-Value=0.3)
          Length = 787

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 13/43 (30%), Positives = 28/43 (65%)
 Frame = -1

Query: 495 SWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDS 367
           ++R     +TT + + ++I +A +D+ ++V ++LLD   AFD+
Sbjct: 70  AYRRFHSTETTLVCVQNDILRA-MDEEKEVILVLLDLSAAFDT 111


>SB_57708| Best HMM Match : Aldedh (HMM E-Value=0)
          Length = 528

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 4/53 (7%)
 Frame = -3

Query: 346 RDRVRSVHDAVVRSDIQPLAKHPGGRPPAPSLFTE----YGRLALEDGGRTPF 200
           RDRV  V D V++SD+       G       L  +      +++LE GG  PF
Sbjct: 206 RDRVNEVTDTVLKSDLVSKMSFTGSTATGKILMAKCVDTVKKMSLELGGNAPF 258


>SB_7362| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 578

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 15/43 (34%), Positives = 24/43 (55%)
 Frame = -1

Query: 495 SWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDS 367
           S++     +T  I + ++I   T+D G  V I+LLD   AFD+
Sbjct: 321 SYKKFHSTETALIKVQNDIL-CTIDGGNSVLILLLDLSAAFDA 362


>SB_54374| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 15/43 (34%), Positives = 24/43 (55%)
 Frame = -1

Query: 495 SWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDS 367
           S++     +T  I + ++I   T+D G  V I+LLD   AFD+
Sbjct: 43  SYKKFHSTETALIKVQNDIL-CTIDGGNSVLILLLDLSAAFDA 84


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,935,986
Number of Sequences: 59808
Number of extensions: 385762
Number of successful extensions: 1196
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 1105
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1196
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1596754500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).