BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0098 (545 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50518| Best HMM Match : 7tm_1 (HMM E-Value=7.8e-32) 28 4.3 SB_14192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 >SB_50518| Best HMM Match : 7tm_1 (HMM E-Value=7.8e-32) Length = 375 Score = 28.3 bits (60), Expect = 4.3 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 205 SRRTDRHYLVCITNYKICAQRKNQGKK 125 +RR R YL C+T C +R +GK+ Sbjct: 294 ARRFRRGYLRCLTRILCCGKRSKEGKR 320 >SB_14192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 28.3 bits (60), Expect = 4.3 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +1 Query: 109 SVLIIIFCLDFFSXRKFCNSLY-RRDNVGQSVYW 207 SV+ I L F + FC++ Y R DNVG +W Sbjct: 169 SVIYSISSLSFVVLQTFCHNKYNRHDNVGFESHW 202 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,376,652 Number of Sequences: 59808 Number of extensions: 268927 Number of successful extensions: 653 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -