SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0039
         (826 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_36217| Best HMM Match : No HMM Matches (HMM E-Value=.)              88   7e-18
SB_8703| Best HMM Match : rve (HMM E-Value=1.5e-22)                    86   3e-17
SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0)                       85   9e-17
SB_43755| Best HMM Match : rve (HMM E-Value=5.6e-11)                   85   9e-17
SB_7177| Best HMM Match : rve (HMM E-Value=4.8e-18)                    84   2e-16
SB_34095| Best HMM Match : No HMM Matches (HMM E-Value=.)              83   2e-16
SB_6196| Best HMM Match : rve (HMM E-Value=3.7e-12)                    83   3e-16
SB_10860| Best HMM Match : No HMM Matches (HMM E-Value=.)              83   3e-16
SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0)                       81   1e-15
SB_9750| Best HMM Match : rve (HMM E-Value=1.2e-37)                    81   1e-15
SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0)                        81   1e-15
SB_38577| Best HMM Match : rve (HMM E-Value=2.4e-24)                   81   1e-15
SB_55817| Best HMM Match : No HMM Matches (HMM E-Value=.)              81   1e-15
SB_47545| Best HMM Match : No HMM Matches (HMM E-Value=.)              80   2e-15
SB_22156| Best HMM Match : No HMM Matches (HMM E-Value=.)              79   4e-15
SB_54838| Best HMM Match : Vitellogenin_N (HMM E-Value=4.76441e-44)    79   4e-15
SB_46540| Best HMM Match : RVT_1 (HMM E-Value=4.8e-27)                 79   6e-15
SB_16055| Best HMM Match : No HMM Matches (HMM E-Value=.)              76   4e-14
SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.)                75   5e-14
SB_21678| Best HMM Match : rve (HMM E-Value=2e-36)                     75   7e-14
SB_17283| Best HMM Match : rve (HMM E-Value=2.5e-35)                   74   2e-13
SB_14775| Best HMM Match : rve (HMM E-Value=6.6e-15)                   70   2e-12
SB_48097| Best HMM Match : rve (HMM E-Value=2.6e-17)                   70   3e-12
SB_11123| Best HMM Match : RVT_1 (HMM E-Value=3.4e-27)                 67   1e-11
SB_52193| Best HMM Match : rve (HMM E-Value=5.8e-20)                   66   3e-11
SB_8975| Best HMM Match : No HMM Matches (HMM E-Value=.)               62   4e-10
SB_20138| Best HMM Match : No HMM Matches (HMM E-Value=.)              61   1e-09
SB_14976| Best HMM Match : rve (HMM E-Value=1.3e-38)                   61   1e-09
SB_45349| Best HMM Match : rve (HMM E-Value=6.1e-31)                   60   2e-09
SB_31673| Best HMM Match : rve (HMM E-Value=6.7e-30)                   60   2e-09
SB_3512| Best HMM Match : rve (HMM E-Value=4.7e-35)                    60   2e-09
SB_27863| Best HMM Match : rve (HMM E-Value=4.7e-35)                   60   2e-09
SB_27381| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35)                   60   3e-09
SB_8339| Best HMM Match : rve (HMM E-Value=5.4e-31)                    60   3e-09
SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   3e-09
SB_19168| Best HMM Match : rve (HMM E-Value=3.9e-38)                   60   3e-09
SB_56941| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35)                   59   4e-09
SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_33992| Best HMM Match : rve (HMM E-Value=6e-35)                     59   4e-09
SB_30312| Best HMM Match : rve (HMM E-Value=5.6e-15)                   59   4e-09
SB_29251| Best HMM Match : rve (HMM E-Value=2.3e-29)                   59   4e-09
SB_24596| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43)           59   4e-09
SB_9298| Best HMM Match : rve (HMM E-Value=4.8e-35)                    59   4e-09
SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30)                    59   4e-09
SB_55004| Best HMM Match : rve (HMM E-Value=8.7e-30)                   59   4e-09
SB_54590| Best HMM Match : rve (HMM E-Value=4.8e-35)                   59   4e-09
SB_51753| Best HMM Match : rve (HMM E-Value=8.7e-30)                   59   4e-09
SB_46176| Best HMM Match : rve (HMM E-Value=8.7e-30)                   59   4e-09
SB_45153| Best HMM Match : rve (HMM E-Value=0)                         59   4e-09
SB_39379| Best HMM Match : rve (HMM E-Value=4.8e-35)                   59   4e-09
SB_30480| Best HMM Match : rve (HMM E-Value=4.8e-35)                   59   4e-09
SB_29849| Best HMM Match : rve (HMM E-Value=4.8e-35)                   59   4e-09
SB_25999| Best HMM Match : rve (HMM E-Value=4.8e-35)                   59   4e-09
SB_24280| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29)                   59   4e-09
SB_12609| Best HMM Match : rve (HMM E-Value=4.8e-35)                   59   4e-09
SB_9355| Best HMM Match : rve (HMM E-Value=4.8e-35)                    59   4e-09
SB_6912| Best HMM Match : rve (HMM E-Value=4.8e-35)                    59   4e-09
SB_5291| Best HMM Match : rve (HMM E-Value=2.3e-35)                    59   4e-09
SB_50945| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   5e-09
SB_49359| Best HMM Match : rve (HMM E-Value=5.5e-37)                   59   5e-09
SB_40370| Best HMM Match : rve (HMM E-Value=1.3e-37)                   59   5e-09
SB_36737| Best HMM Match : rve (HMM E-Value=1.4e-38)                   59   5e-09
SB_28729| Best HMM Match : rve (HMM E-Value=1.4e-38)                   59   5e-09
SB_14178| Best HMM Match : rve (HMM E-Value=1.4e-38)                   59   5e-09
SB_42915| Best HMM Match : rve (HMM E-Value=1.4e-38)                   59   5e-09
SB_39602| Best HMM Match : rve (HMM E-Value=1.4e-38)                   59   5e-09
SB_31504| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   5e-09
SB_16657| Best HMM Match : RVT_1 (HMM E-Value=6.4e-18)                 59   5e-09
SB_4255| Best HMM Match : rve (HMM E-Value=1.4e-38)                    59   5e-09
SB_3392| Best HMM Match : rve (HMM E-Value=1.4e-38)                    59   5e-09
SB_15656| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   7e-09
SB_41743| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_20314| Best HMM Match : RVT_1 (HMM E-Value=1e-32)                   58   1e-08
SB_39760| Best HMM Match : rve (HMM E-Value=1.1e-29)                   58   1e-08
SB_59085| Best HMM Match : rve (HMM E-Value=0.00048)                   57   2e-08
SB_48772| Best HMM Match : rve (HMM E-Value=4.2e-35)                   57   2e-08
SB_59677| Best HMM Match : RVT_1 (HMM E-Value=2.1e-28)                 56   3e-08
SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_30319| Best HMM Match : rve (HMM E-Value=1.2e-37)                   56   3e-08
SB_2192| Best HMM Match : rve (HMM E-Value=4e-23)                      56   3e-08
SB_51339| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_47959| Best HMM Match : rve (HMM E-Value=3e-29)                     56   3e-08
SB_34135| Best HMM Match : rve (HMM E-Value=3e-29)                     56   3e-08
SB_26192| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     56   3e-08
SB_55915| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_54416| Best HMM Match : rve (HMM E-Value=1.4e-27)                   56   3e-08
SB_13256| Best HMM Match : rve (HMM E-Value=1.1e-17)                   56   3e-08
SB_58283| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   5e-08
SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37)                 56   5e-08
SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   5e-08
SB_49093| Best HMM Match : rve (HMM E-Value=1.5e-17)                   56   5e-08
SB_57310| Best HMM Match : rve (HMM E-Value=2.5e-25)                   56   5e-08
SB_51546| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   5e-08
SB_31556| Best HMM Match : rve (HMM E-Value=4.7e-30)                   56   5e-08
SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   5e-08
SB_58163| Best HMM Match : rve (HMM E-Value=9e-32)                     55   6e-08
SB_39667| Best HMM Match : rve (HMM E-Value=9e-32)                     55   6e-08
SB_43121| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)                 55   8e-08
SB_13455| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   8e-08
SB_8981| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   8e-08
SB_3438| Best HMM Match : RVT_1 (HMM E-Value=1.3e-30)                  55   8e-08
SB_54349| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_49072| Best HMM Match : rve (HMM E-Value=2.7e-29)                   54   1e-07
SB_48126| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39)                 54   1e-07
SB_47416| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_37298| Best HMM Match : rve (HMM E-Value=2.7e-29)                   54   1e-07
SB_25140| Best HMM Match : RVT_1 (HMM E-Value=7.8e-38)                 54   1e-07
SB_23893| Best HMM Match : rve (HMM E-Value=3.1e-24)                   54   1e-07
SB_51971| Best HMM Match : rve (HMM E-Value=7.7e-31)                   54   1e-07
SB_45121| Best HMM Match : rve (HMM E-Value=3.8e-09)                   54   1e-07
SB_33948| Best HMM Match : rve (HMM E-Value=2.8e-29)                   54   1e-07
SB_29114| Best HMM Match : rve (HMM E-Value=1.9e-23)                   54   1e-07
SB_3471| Best HMM Match : rve (HMM E-Value=2.7e-29)                    54   1e-07
SB_48278| Best HMM Match : rve (HMM E-Value=7.1e-28)                   54   1e-07
SB_44967| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_39528| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_37763| Best HMM Match : rve (HMM E-Value=4.2e-27)                   54   1e-07
SB_28906| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_21743| Best HMM Match : rve (HMM E-Value=4e-17)                     54   1e-07
SB_46895| Best HMM Match : rve (HMM E-Value=1.6e-25)                   54   2e-07
SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0)                 54   2e-07
SB_23051| Best HMM Match : No HMM Matches (HMM E-Value=.)              53   2e-07
SB_2808| Best HMM Match : No HMM Matches (HMM E-Value=.)               53   2e-07
SB_52251| Best HMM Match : rve (HMM E-Value=1.1e-34)                   53   3e-07
SB_45195| Best HMM Match : rve (HMM E-Value=0.56)                      53   3e-07
SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.)               53   3e-07
SB_52339| Best HMM Match : No HMM Matches (HMM E-Value=.)              53   3e-07
SB_12601| Best HMM Match : rve (HMM E-Value=5e-29)                     53   3e-07
SB_9047| Best HMM Match : RVT_1 (HMM E-Value=3.4e-19)                  53   3e-07
SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33)                     53   3e-07
SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   4e-07
SB_46816| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   4e-07
SB_31771| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   4e-07
SB_49535| Best HMM Match : RVT_1 (HMM E-Value=5.1e-32)                 52   6e-07
SB_47875| Best HMM Match : rve (HMM E-Value=3.3e-16)                   52   6e-07
SB_31380| Best HMM Match : zf-CCHC (HMM E-Value=4.6e-05)               52   8e-07
SB_19382| Best HMM Match : rve (HMM E-Value=8.4e-26)                   52   8e-07
SB_19374| Best HMM Match : Phage_integrase (HMM E-Value=4.3)           52   8e-07
SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39)                 51   1e-06
SB_4361| Best HMM Match : No HMM Matches (HMM E-Value=.)               51   1e-06
SB_49679| Best HMM Match : rve (HMM E-Value=8.4e-27)                   51   1e-06
SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39)                 51   1e-06
SB_24579| Best HMM Match : rve (HMM E-Value=0.085)                     51   1e-06
SB_48661| Best HMM Match : rve (HMM E-Value=5.7e-17)                   51   1e-06
SB_2089| Best HMM Match : rve (HMM E-Value=4.3e-20)                    51   1e-06
SB_38188| Best HMM Match : rve (HMM E-Value=5.7e-31)                   50   2e-06
SB_32999| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   2e-06
SB_1340| Best HMM Match : rve (HMM E-Value=3.1e-14)                    50   2e-06
SB_51002| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   2e-06
SB_3768| Best HMM Match : Involucrin (HMM E-Value=0.021)               50   2e-06
SB_44798| Best HMM Match : rve (HMM E-Value=3.4e-33)                   50   3e-06
SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36)                   50   3e-06
SB_56534| Best HMM Match : RVT_1 (HMM E-Value=5.5e-28)                 49   4e-06
SB_12161| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   4e-06
SB_3041| Best HMM Match : No HMM Matches (HMM E-Value=.)               49   4e-06
SB_33828| Best HMM Match : rve (HMM E-Value=3.9e-20)                   49   4e-06
SB_20630| Best HMM Match : rve (HMM E-Value=2.3e-19)                   49   5e-06
SB_57797| Best HMM Match : rve (HMM E-Value=6.9e-21)                   48   7e-06
SB_55060| Best HMM Match : rve (HMM E-Value=0.0085)                    48   7e-06
SB_53148| Best HMM Match : rve (HMM E-Value=4.8e-21)                   48   7e-06
SB_31616| Best HMM Match : rve (HMM E-Value=6.9e-21)                   48   7e-06
SB_24272| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21)                 48   7e-06
SB_17261| Best HMM Match : rve (HMM E-Value=6.9e-21)                   48   7e-06
SB_15802| Best HMM Match : rve (HMM E-Value=6.9e-21)                   48   7e-06
SB_59754| Best HMM Match : rve (HMM E-Value=8e-19)                     48   7e-06
SB_37291| Best HMM Match : rve (HMM E-Value=4.8e-19)                   48   7e-06
SB_23407| Best HMM Match : rve (HMM E-Value=6.9e-21)                   48   7e-06
SB_12115| Best HMM Match : rve (HMM E-Value=6.9e-21)                   48   7e-06
SB_10467| Best HMM Match : zf-PARP (HMM E-Value=5.6e-35)               48   7e-06
SB_25312| Best HMM Match : Vicilin_N (HMM E-Value=0.61)                48   9e-06
SB_50857| Best HMM Match : RVT_1 (HMM E-Value=9.8e-33)                 48   1e-05
SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_25583| Best HMM Match : rve (HMM E-Value=5.9e-05)                   48   1e-05
SB_23305| Best HMM Match : RVT_1 (HMM E-Value=0.0013)                  48   1e-05
SB_10363| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_41747| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   2e-05
SB_9257| Best HMM Match : RVT_1 (HMM E-Value=9.1e-32)                  47   2e-05
SB_44206| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   2e-05
SB_25794| Best HMM Match : rve (HMM E-Value=6.6e-17)                   47   2e-05
SB_20716| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   2e-05
SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.)               47   2e-05
SB_49747| Best HMM Match : RVT_1 (HMM E-Value=2.1e-36)                 47   2e-05
SB_47161| Best HMM Match : rve (HMM E-Value=1.8e-22)                   47   2e-05
SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25)                 47   2e-05
SB_45729| Best HMM Match : rve (HMM E-Value=5.8e-21)                   47   2e-05
SB_15544| Best HMM Match : rve (HMM E-Value=9.6e-05)                   47   2e-05
SB_25619| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   3e-05
SB_12331| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   3e-05
SB_45481| Best HMM Match : rve (HMM E-Value=3.1e-17)                   46   3e-05
SB_33158| Best HMM Match : rve (HMM E-Value=7.5e-05)                   46   3e-05
SB_1797| Best HMM Match : rve (HMM E-Value=8.5e-35)                    46   3e-05
SB_58301| Best HMM Match : DUF1168 (HMM E-Value=7.6)                   46   4e-05
SB_53641| Best HMM Match : rve (HMM E-Value=7.9e-14)                   46   4e-05
SB_53108| Best HMM Match : DUF1168 (HMM E-Value=7.1)                   46   4e-05
SB_49427| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   4e-05
SB_2953| Best HMM Match : DUF1168 (HMM E-Value=7.6)                    46   4e-05
SB_46458| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   4e-05
SB_44253| Best HMM Match : rve (HMM E-Value=8.4e-10)                   46   4e-05
SB_23363| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   4e-05
SB_20587| Best HMM Match : rve (HMM E-Value=7.2e-15)                   46   5e-05
SB_12598| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_11668| Best HMM Match : rve (HMM E-Value=6.2e-14)                   46   5e-05
SB_7962| Best HMM Match : No HMM Matches (HMM E-Value=.)               46   5e-05
SB_59576| Best HMM Match : rve (HMM E-Value=3.7e-14)                   46   5e-05
SB_23039| Best HMM Match : rve (HMM E-Value=2.8e-20)                   46   5e-05
SB_53393| Best HMM Match : RVT_1 (HMM E-Value=5.8e-30)                 45   7e-05
SB_29642| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_27280| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_3315| Best HMM Match : No HMM Matches (HMM E-Value=.)               45   7e-05
SB_25412| Best HMM Match : rve (HMM E-Value=1.6e-05)                   45   7e-05
SB_59388| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   9e-05
SB_56290| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   9e-05
SB_37239| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19)                 44   1e-04
SB_19553| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45)           44   1e-04
SB_54350| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_16778| Best HMM Match : rve (HMM E-Value=2.9e-22)                   44   1e-04
SB_10389| Best HMM Match : rve (HMM E-Value=1.8e-15)                   44   1e-04
SB_59067| Best HMM Match : rve (HMM E-Value=2.1e-15)                   44   2e-04
SB_57305| Best HMM Match : rve (HMM E-Value=6.6e-22)                   44   2e-04
SB_41311| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_37892| Best HMM Match : rve (HMM E-Value=2.1e-16)                   44   2e-04
SB_37630| Best HMM Match : rve (HMM E-Value=4e-24)                     44   2e-04
SB_34864| Best HMM Match : rve (HMM E-Value=2.9e-16)                   44   2e-04
SB_25327| Best HMM Match : rve (HMM E-Value=6.6e-22)                   44   2e-04
SB_15534| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_12365| Best HMM Match : rve (HMM E-Value=0.00031)                   44   2e-04
SB_58333| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_53337| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_50204| Best HMM Match : rve (HMM E-Value=6.6e-22)                   44   2e-04
SB_34611| Best HMM Match : rve (HMM E-Value=6.6e-22)                   44   2e-04
SB_30291| Best HMM Match : rve (HMM E-Value=5.3e-16)                   44   2e-04
SB_25480| Best HMM Match : rve (HMM E-Value=6.6e-22)                   44   2e-04
SB_24099| Best HMM Match : rve (HMM E-Value=5.3e-16)                   44   2e-04
SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_16804| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26)                 44   2e-04
SB_16064| Best HMM Match : rve (HMM E-Value=6.6e-22)                   44   2e-04
SB_13623| Best HMM Match : rve (HMM E-Value=0.00044)                   44   2e-04
SB_11912| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26)                 44   2e-04
SB_4516| Best HMM Match : rve (HMM E-Value=6.5)                        44   2e-04
SB_2280| Best HMM Match : RVT_1 (HMM E-Value=1.4e-25)                  44   2e-04
SB_52774| Best HMM Match : rve (HMM E-Value=2e-17)                     44   2e-04
SB_31354| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_17624| Best HMM Match : rve (HMM E-Value=2.2e-11)                   44   2e-04
SB_10923| Best HMM Match : rve (HMM E-Value=0.0014)                    44   2e-04
SB_58621| Best HMM Match : RVT_1 (HMM E-Value=1.5e-25)                 44   2e-04
SB_55917| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_50560| Best HMM Match : rve (HMM E-Value=7.2e-15)                   44   2e-04
SB_30683| Best HMM Match : rve (HMM E-Value=1.9e-13)                   44   2e-04
SB_27075| Best HMM Match : rve (HMM E-Value=1.5e-16)                   44   2e-04
SB_24375| Best HMM Match : rve (HMM E-Value=7.2e-15)                   44   2e-04
SB_23420| Best HMM Match : rve (HMM E-Value=2.7e-11)                   44   2e-04
SB_14191| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_13788| Best HMM Match : rve (HMM E-Value=0.00016)                   44   2e-04
SB_4782| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   2e-04
SB_30000| Best HMM Match : rve (HMM E-Value=2.4e-11)                   43   3e-04
SB_9953| Best HMM Match : VWA (HMM E-Value=0)                          43   3e-04
SB_48888| Best HMM Match : rve (HMM E-Value=6.4e-33)                   43   3e-04
SB_45972| Best HMM Match : Ribosomal_L21e (HMM E-Value=9)              43   3e-04
SB_27233| Best HMM Match : SH3_1 (HMM E-Value=0.18)                    43   3e-04
SB_1665| Best HMM Match : rve (HMM E-Value=3.1e-10)                    43   3e-04
SB_40189| Best HMM Match : rve (HMM E-Value=1.4e-08)                   43   3e-04
SB_39899| Best HMM Match : rve (HMM E-Value=5.9e-27)                   43   3e-04
SB_25425| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_22261| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_18792| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_11084| Best HMM Match : rve (HMM E-Value=5.6e-16)                   43   3e-04
SB_53291| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_41998| Best HMM Match : Nol1_Nop2_Fmu (HMM E-Value=3.2e-16)         43   3e-04
SB_31709| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_52035| Best HMM Match : RVT_1 (HMM E-Value=0.067)                   42   5e-04
SB_30671| Best HMM Match : rve (HMM E-Value=6.2e-32)                   42   5e-04
SB_17257| Best HMM Match : rve (HMM E-Value=8.3e-08)                   42   5e-04
SB_33000| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   5e-04
SB_24041| Best HMM Match : rve (HMM E-Value=9.7e-08)                   42   5e-04
SB_31801| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_13901| Best HMM Match : rve (HMM E-Value=5.5e-29)                   42   6e-04
SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21)                 42   6e-04
SB_47014| Best HMM Match : rve (HMM E-Value=6.8e-21)                   42   8e-04
SB_47002| Best HMM Match : RVT_1 (HMM E-Value=1.5e-16)                 42   8e-04
SB_37558| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   8e-04
SB_18201| Best HMM Match : rve (HMM E-Value=3.6e-21)                   42   8e-04
SB_13117| Best HMM Match : rve (HMM E-Value=0.00037)                   42   8e-04
SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12)                     42   8e-04
SB_144| Best HMM Match : rve (HMM E-Value=3.6e-21)                     42   8e-04
SB_52460| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   8e-04
SB_51361| Best HMM Match : rve (HMM E-Value=6.4e-14)                   42   8e-04
SB_26036| Best HMM Match : rve (HMM E-Value=0.00011)                   42   8e-04
SB_1893| Best HMM Match : rve (HMM E-Value=0.0043)                     42   8e-04
SB_42812| Best HMM Match : RVT_1 (HMM E-Value=8.4e-19)                 41   0.001
SB_21960| Best HMM Match : rve (HMM E-Value=4e-23)                     41   0.001
SB_14016| Best HMM Match : rve (HMM E-Value=0.0027)                    41   0.001
SB_10281| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   0.001
SB_6614| Best HMM Match : No HMM Matches (HMM E-Value=.)               41   0.001
SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31)                   41   0.001
SB_45142| Best HMM Match : Herpes_IE68 (HMM E-Value=3.8)               41   0.001
SB_16776| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   0.001
SB_45108| Best HMM Match : RVT_1 (HMM E-Value=4.9e-37)                 41   0.001
SB_39489| Best HMM Match : rve (HMM E-Value=1.7e-20)                   41   0.001
SB_18945| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   0.001
SB_11383| Best HMM Match : rve (HMM E-Value=2.3e-18)                   41   0.001
SB_49485| Best HMM Match : rve (HMM E-Value=0.00023)                   40   0.002
SB_41962| Best HMM Match : RVT_1 (HMM E-Value=1.4e-18)                 40   0.002
SB_23070| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_14466| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_5772| Best HMM Match : rve (HMM E-Value=4.9e-13)                    40   0.002
SB_1510| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.002
SB_46264| Best HMM Match : rve (HMM E-Value=1.9e-16)                   40   0.002
SB_44255| Best HMM Match : RVT_1 (HMM E-Value=7.6e-29)                 40   0.002
SB_36817| Best HMM Match : rve (HMM E-Value=6.2e-36)                   40   0.002
SB_8183| Best HMM Match : rve (HMM E-Value=1.7e-10)                    40   0.002
SB_52213| Best HMM Match : rve (HMM E-Value=5.1e-05)                   40   0.003
SB_40427| Best HMM Match : rve (HMM E-Value=2.7e-05)                   40   0.003
SB_23563| Best HMM Match : rve (HMM E-Value=3.3e-25)                   40   0.003
SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_50619| Best HMM Match : RnaseH (HMM E-Value=0.89)                   40   0.003
SB_59190| Best HMM Match : rve (HMM E-Value=6e-18)                     39   0.004
SB_58675| Best HMM Match : RVT_1 (HMM E-Value=0)                       39   0.004
SB_43123| Best HMM Match : rve (HMM E-Value=6e-18)                     39   0.004
SB_39709| Best HMM Match : rve (HMM E-Value=6e-18)                     39   0.004
SB_19527| Best HMM Match : rve (HMM E-Value=1e-20)                     39   0.004
SB_16047| Best HMM Match : rve (HMM E-Value=2e-12)                     39   0.004
SB_13442| Best HMM Match : rve (HMM E-Value=2.3e-13)                   39   0.004
SB_4292| Best HMM Match : rve (HMM E-Value=0.0023)                     39   0.004
SB_58943| Best HMM Match : rve (HMM E-Value=6.1e-13)                   39   0.004
SB_58000| Best HMM Match : MATH (HMM E-Value=1.1e-19)                  39   0.004
SB_46067| Best HMM Match : rve (HMM E-Value=6e-18)                     39   0.004
SB_39524| Best HMM Match : rve (HMM E-Value=9.1e-17)                   39   0.004
SB_29974| Best HMM Match : RVT_1 (HMM E-Value=3e-17)                   39   0.004
SB_27411| Best HMM Match : RVT_1 (HMM E-Value=0.002)                   39   0.004
SB_17588| Best HMM Match : rve (HMM E-Value=2.9e-05)                   39   0.004
SB_7045| Best HMM Match : rve (HMM E-Value=3.8e-22)                    39   0.004
SB_45323| Best HMM Match : rve (HMM E-Value=5.3e-31)                   39   0.006
SB_5129| Best HMM Match : No HMM Matches (HMM E-Value=.)               39   0.006
SB_33705| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.006
SB_710| Best HMM Match : rve (HMM E-Value=0.003)                       39   0.006
SB_34308| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.007
SB_14677| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.007
SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.)                 38   0.007
SB_56665| Best HMM Match : rve (HMM E-Value=8.6e-16)                   38   0.010
SB_55980| Best HMM Match : rve (HMM E-Value=3.8e-23)                   38   0.010
SB_43653| Best HMM Match : rve (HMM E-Value=5.4e-26)                   38   0.010
SB_28715| Best HMM Match : rve (HMM E-Value=5.4e-26)                   38   0.010
SB_26190| Best HMM Match : rve (HMM E-Value=3.1e-26)                   38   0.010
SB_26129| Best HMM Match : RVT_1 (HMM E-Value=1.2e-27)                 38   0.010
SB_20817| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.010
SB_4788| Best HMM Match : rve (HMM E-Value=0)                          38   0.010
SB_952| Best HMM Match : rve (HMM E-Value=9.4e-26)                     38   0.010
SB_46104| Best HMM Match : rve (HMM E-Value=1.4e-10)                   38   0.010
SB_45708| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.010
SB_43181| Best HMM Match : rve (HMM E-Value=1e-25)                     38   0.010
SB_39172| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.010
SB_21794| Best HMM Match : rve (HMM E-Value=5.4e-26)                   38   0.010
SB_19509| Best HMM Match : rve (HMM E-Value=5.4e-26)                   38   0.010
SB_13818| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.010
SB_8019| Best HMM Match : No HMM Matches (HMM E-Value=.)               38   0.010
SB_14926| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.013
SB_58082| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.017
SB_35539| Best HMM Match : RVT_1 (HMM E-Value=1.7e-07)                 37   0.017
SB_18798| Best HMM Match : rve (HMM E-Value=2.2e-20)                   37   0.017
SB_3577| Best HMM Match : No HMM Matches (HMM E-Value=.)               37   0.017
SB_46591| Best HMM Match : rve (HMM E-Value=6.5e-29)                   37   0.023
SB_46362| Best HMM Match : rve (HMM E-Value=3e-26)                     37   0.023
SB_3539| Best HMM Match : rve (HMM E-Value=5.6e-11)                    37   0.023
SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08)                     37   0.023
SB_46587| Best HMM Match : rve (HMM E-Value=1e-04)                     36   0.030
SB_41075| Best HMM Match : RVT_1 (HMM E-Value=2.1e-30)                 36   0.030
SB_18330| Best HMM Match : rve (HMM E-Value=1.2e-16)                   36   0.030
SB_9739| Best HMM Match : No HMM Matches (HMM E-Value=.)               36   0.030
SB_48318| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.040
SB_45137| Best HMM Match : Involucrin2 (HMM E-Value=0.59)              36   0.040
SB_41979| Best HMM Match : rve (HMM E-Value=1.3e-23)                   36   0.040
SB_10317| Best HMM Match : rve (HMM E-Value=8e-07)                     36   0.040
SB_8944| Best HMM Match : RVT_1 (HMM E-Value=1.3e-05)                  36   0.040
SB_42224| Best HMM Match : rve (HMM E-Value=8.6e-14)                   36   0.053
SB_31270| Best HMM Match : rve (HMM E-Value=0.0043)                    36   0.053
SB_13803| Best HMM Match : rve (HMM E-Value=8.6e-14)                   36   0.053
SB_36929| Best HMM Match : rve (HMM E-Value=1.2e-16)                   36   0.053
SB_11157| Best HMM Match : NUC173 (HMM E-Value=9.2e-39)                36   0.053
SB_7198| Best HMM Match : rve (HMM E-Value=3.5e-14)                    36   0.053
SB_2890| Best HMM Match : rve (HMM E-Value=0.044)                      36   0.053
SB_130| Best HMM Match : rve (HMM E-Value=0.0043)                      36   0.053
SB_28310| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.070
SB_27367| Best HMM Match : rve (HMM E-Value=9.5e-17)                   35   0.070
SB_22427| Best HMM Match : rve (HMM E-Value=7.5e-12)                   35   0.070
SB_17285| Best HMM Match : rve (HMM E-Value=1.3e-16)                   35   0.070
SB_54654| Best HMM Match : rve (HMM E-Value=0.0035)                    35   0.070
SB_23747| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.070
SB_17926| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.070
SB_6769| Best HMM Match : rve (HMM E-Value=3.5e-19)                    35   0.092
SB_5144| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.092
SB_56418| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-35)         35   0.092
SB_54427| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.092
SB_53966| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11)                 35   0.092
SB_57835| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.12 
SB_37431| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.12 
SB_13018| Best HMM Match : rve (HMM E-Value=1e-04)                     34   0.12 
SB_52004| Best HMM Match : rve (HMM E-Value=1.2e-16)                   34   0.16 
SB_36930| Best HMM Match : rve (HMM E-Value=0.016)                     34   0.16 
SB_57666| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.16 
SB_41135| Best HMM Match : Ribonuc_red_lgN (HMM E-Value=0.78)          34   0.16 
SB_37122| Best HMM Match : rve (HMM E-Value=1.3)                       34   0.16 
SB_9010| Best HMM Match : RVP (HMM E-Value=0.14)                       34   0.16 
SB_44128| Best HMM Match : rve (HMM E-Value=0.0074)                    33   0.28 
SB_20246| Best HMM Match : RVT_1 (HMM E-Value=1.4e-30)                 33   0.28 
SB_31097| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.28 
SB_24226| Best HMM Match : rve (HMM E-Value=0.0023)                    33   0.28 
SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.28 
SB_4690| Best HMM Match : rve (HMM E-Value=1.5)                        33   0.28 
SB_42197| Best HMM Match : rve (HMM E-Value=0.017)                     33   0.37 
SB_8467| Best HMM Match : rve (HMM E-Value=2.4e-13)                    33   0.37 
SB_4272| Best HMM Match : RVT_1 (HMM E-Value=2e-28)                    33   0.37 
SB_31154| Best HMM Match : rve (HMM E-Value=2.5e-12)                   33   0.37 
SB_37116| Best HMM Match : rve (HMM E-Value=0.00013)                   32   0.49 
SB_17842| Best HMM Match : RVT_1 (HMM E-Value=2.2e-29)                 32   0.49 
SB_15669| Best HMM Match : rve (HMM E-Value=0.00013)                   32   0.49 
SB_53795| Best HMM Match : rve (HMM E-Value=5.9e-15)                   32   0.65 
SB_53279| Best HMM Match : rve (HMM E-Value=5.2e-36)                   32   0.65 
SB_49675| Best HMM Match : rve (HMM E-Value=5.2e-36)                   32   0.65 
SB_48115| Best HMM Match : rve (HMM E-Value=5.3e-36)                   32   0.65 
SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36)                   32   0.65 
SB_24479| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.65 
SB_15390| Best HMM Match : rve (HMM E-Value=5.2e-36)                   32   0.65 
SB_2678| Best HMM Match : No HMM Matches (HMM E-Value=.)               32   0.65 
SB_491| Best HMM Match : rve (HMM E-Value=0.017)                       32   0.65 
SB_42299| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.65 
SB_40058| Best HMM Match : rve (HMM E-Value=5.2e-36)                   32   0.65 
SB_35360| Best HMM Match : rve (HMM E-Value=0.014)                     32   0.65 
SB_24279| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.65 
SB_18717| Best HMM Match : rve (HMM E-Value=0.017)                     32   0.65 
SB_13151| Best HMM Match : rve (HMM E-Value=0.017)                     32   0.65 
SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36)                    32   0.65 
SB_1625| Best HMM Match : No HMM Matches (HMM E-Value=.)               32   0.65 
SB_42582| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.86 
SB_35147| Best HMM Match : rve (HMM E-Value=0.019)                     31   0.86 
SB_34652| Best HMM Match : Ank (HMM E-Value=3.8e-34)                   31   0.86 
SB_28694| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28)                 31   0.86 
SB_56054| Best HMM Match : rve (HMM E-Value=0.011)                     31   1.1  
SB_49129| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.1  
SB_15142| Best HMM Match : rve (HMM E-Value=1.1e-13)                   31   1.1  
SB_11948| Best HMM Match : rve (HMM E-Value=5.3e-11)                   31   1.1  
SB_38788| Best HMM Match : rve (HMM E-Value=4e-06)                     31   1.5  
SB_27175| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.5  
SB_14213| Best HMM Match : RVT_1 (HMM E-Value=1.4e-24)                 31   1.5  
SB_11644| Best HMM Match : Pox_A32 (HMM E-Value=0.026)                 31   1.5  
SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.5  
SB_7961| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.5  
SB_45890| Best HMM Match : TMP_2 (HMM E-Value=4.4)                     30   2.0  
SB_40445| Best HMM Match : rve (HMM E-Value=0.0008)                    30   2.0  
SB_38857| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.0  
SB_20812| Best HMM Match : rve (HMM E-Value=1.2e-25)                   30   2.0  
SB_58386| Best HMM Match : rve (HMM E-Value=8.6e-26)                   30   2.0  
SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.)               30   2.0  
SB_43276| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     30   2.6  
SB_6983| Best HMM Match : rve (HMM E-Value=0.011)                      30   2.6  
SB_3588| Best HMM Match : No HMM Matches (HMM E-Value=.)               30   2.6  
SB_44531| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.5  
SB_41936| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.5  
SB_28653| Best HMM Match : rve (HMM E-Value=8.4e-10)                   29   3.5  
SB_23869| Best HMM Match : rve (HMM E-Value=2.2e-16)                   29   3.5  
SB_16736| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17)                 29   3.5  
SB_284| Best HMM Match : rve (HMM E-Value=0.001)                       29   3.5  
SB_17836| Best HMM Match : rve (HMM E-Value=7.3e-14)                   29   3.5  
SB_619| Best HMM Match : rve (HMM E-Value=0.027)                       29   3.5  
SB_27551| Best HMM Match : rve (HMM E-Value=6.3e-25)                   29   4.6  
SB_50021| Best HMM Match : rve (HMM E-Value=0.043)                     29   4.6  
SB_49099| Best HMM Match : rve (HMM E-Value=2e-08)                     29   4.6  
SB_39617| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38)                 29   4.6  
SB_31861| Best HMM Match : rve (HMM E-Value=3.6e-07)                   29   4.6  
SB_23220| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)                 29   4.6  
SB_21616| Best HMM Match : RVT_1 (HMM E-Value=0.00011)                 29   4.6  
SB_18045| Best HMM Match : rve (HMM E-Value=0.25)                      29   4.6  
SB_49727| Best HMM Match : RVT_1 (HMM E-Value=4.5e-07)                 29   6.1  
SB_45219| Best HMM Match : rve (HMM E-Value=3e-14)                     29   6.1  
SB_28707| Best HMM Match : rve (HMM E-Value=0.011)                     29   6.1  
SB_650| Best HMM Match : rve (HMM E-Value=0.00048)                     29   6.1  
SB_39665| Best HMM Match : Pox_A32 (HMM E-Value=0.023)                 28   8.0  
SB_36311| Best HMM Match : Pox_A32 (HMM E-Value=0.16)                  28   8.0  
SB_17924| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.0  
SB_15292| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.0  
SB_13174| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.0  
SB_32990| Best HMM Match : Pox_A32 (HMM E-Value=0.023)                 28   8.0  
SB_24571| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.0  

>SB_36217| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1356

 Score = 88.2 bits (209), Expect = 7e-18
 Identities = 41/114 (35%), Positives = 66/114 (57%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I +DQG +F +EV+++L +L+G+K    +PYHPQ  G  +R + TL + LR+   
Sbjct: 1052 GVPHRIHSDQGRSFEAEVVQELCQLYGVKKSRTTPYHPQGNGQCDRFNRTLHDLLRTLPA 1111

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
            + +  W  +L+     YN+ +H TTG+SP  L+FG    +P  I   D   + D
Sbjct: 1112 DKKRRWPEHLKELCYGYNATLHGTTGYSPFYLIFGRDARLPVDILLPDSAAHKD 1165


>SB_8703| Best HMM Match : rve (HMM E-Value=1.5e-22)
          Length = 382

 Score = 86.2 bits (204), Expect = 3e-17
 Identities = 49/140 (35%), Positives = 76/140 (54%), Gaps = 5/140 (3%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+ + +DQG +F S +++ L RL  ++    +PYHPQ  G  ER + TL   L +  V
Sbjct: 76  GFPQRLHSDQGRDFESRLLRDLCRLANVEKSRTTPYHPQGNGQTERFNRTLHNMLGTLEV 135

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI----DSL-DLNTYSDY 479
           + +  W  Y+   + AYN+  HSTT +SP  L+FG  P +P+ +    D + D   Y+ Y
Sbjct: 136 DKKKDWPDYVARLVHAYNATKHSTTEYSPSYLMFGRNPRLPQDVTLGPDPVHDPQPYAAY 195

Query: 478 IRALNHRLYYSRQKALQNIE 419
           I  L  +L  +  +A Q IE
Sbjct: 196 IENLRDKLTDAYSRAQQEIE 215


>SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 2639

 Score = 84.6 bits (200), Expect = 9e-17
 Identities = 36/105 (34%), Positives = 67/105 (63%)
 Frame = -1

Query: 817  PKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
            P  +++D+G NF SE+++++ ++F I+ +  + YHPQ  G +ERS+S+L + L  Y+   
Sbjct: 1304 PNQLLSDRGKNFLSELVQEVCKIFSIRKVQTTAYHPQCDGLVERSNSSLIQSLSMYLDVK 1363

Query: 637  QHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSL 503
            Q  WD+++ + + A+ ++I  +TG SP  LL+G  P +P  +  L
Sbjct: 1364 QKDWDIFIPSVLFAHRTSISDSTGDSPFYLLYGRSPRLPIDVSLL 1408


>SB_43755| Best HMM Match : rve (HMM E-Value=5.6e-11)
          Length = 461

 Score = 84.6 bits (200), Expect = 9e-17
 Identities = 36/96 (37%), Positives = 59/96 (61%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  + +DQG NF S+V  ++ +L GI     +P HP++   ++R + TLK+YL  +  
Sbjct: 222 GVPLELHSDQGRNFESQVFLEVCKLLGINKTRTTPAHPESDNMVDRYNRTLKDYLAKFTA 281

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGF 536
            NQ TWD  +  A+LAY S +H  T ++P  ++FG+
Sbjct: 282 ANQQTWDRDVPLALLAYRSAVHEATSYTPACMMFGY 317


>SB_7177| Best HMM Match : rve (HMM E-Value=4.8e-18)
          Length = 311

 Score = 83.8 bits (198), Expect = 2e-16
 Identities = 39/104 (37%), Positives = 64/104 (61%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+ + +DQGAN +S+ ++++ +   +     +P+HPQ+ GA ERS  T+   L   + 
Sbjct: 53  GAPEQLHSDQGANLNSQNIEEICQYLEVLKTRPTPFHPQSDGASERSIRTVNAMLAKVVS 112

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
           + Q  WDLYL T  LAYN+ +HS+TG++P  L FG +  +P  +
Sbjct: 113 DVQKNWDLYLSTTCLAYNTAVHSSTGYTPSYLEFGRELRLPTDL 156


>SB_34095| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 465

 Score = 83.4 bits (197), Expect = 2e-16
 Identities = 43/107 (40%), Positives = 66/107 (61%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ I +DQG  F +EV+++L +L+GIK    +PYHPQ  G  ER + +L + LR+   
Sbjct: 177 GVPQRIHSDQGRCFEAEVVQELCQLYGIKKSRTTPYHPQGNGQCERFNRSLHDLLRTLPA 236

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSL 503
           + +  W  +L+     YN+  HSTTG+SP   LFG   ++P  ID+L
Sbjct: 237 DKKRRWPEHLKEICYGYNATPHSTTGYSPF-YLFGRDAHLP--IDTL 280


>SB_6196| Best HMM Match : rve (HMM E-Value=3.7e-12)
          Length = 444

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 46/139 (33%), Positives = 75/139 (53%), Gaps = 5/139 (3%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  + +DQ  NF S+V  ++ +L GI     +  HP++ G +ER   TLK+YL  +  
Sbjct: 157 GVPLELHSDQWRNFESQVFLEVCKLLGINKTRTTLAHPESDGMVERYKGTLKDYLAKFTA 216

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI----DSLDLN-TYSDY 479
            NQ TWD  +  A+LAY S +H  TG++P  ++FG +  +P  +      ++ N   S++
Sbjct: 217 ANQQTWDRDVPLALLAYRSAVHEATGYTPACMMFGRELRLPIDLMFERPMMNENGNASEH 276

Query: 478 IRALNHRLYYSRQKALQNI 422
           +R L   L   R  A  N+
Sbjct: 277 VRDLRESLEAVRADARDNL 295


>SB_10860| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1292

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 39/104 (37%), Positives = 61/104 (58%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P+ + +DQG +F S +++ L RL  ++    +PYHPQ  G  ER + TL   L +  V
Sbjct: 976  GFPQRLHSDQGRDFESRLLRDLCRLANVEKSRTTPYHPQGNGQTERFNRTLHNMLGTLEV 1035

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
            + +  W  Y+   + AYN+  HSTTG+SP  L+FG  P +P+ +
Sbjct: 1036 DKKKDWPDYVARLVHAYNATKHSTTGYSPSYLMFGRNPRLPQDV 1079


>SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 1020

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 43/102 (42%), Positives = 60/102 (58%), Gaps = 1/102 (0%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P  I  DQG  F +++ K LE+L G+ H   +PYHPQ+ G +ER + TL   LR+ + 
Sbjct: 621 GFPLRIHHDQGKEFENDLHKHLEKLSGVAHSRTTPYHPQSNGQVERFNQTLLAMLRT-LP 679

Query: 643 ENQHT-WDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           ENQ + W   L   + AYN   + +TGFSP  LL+G  P +P
Sbjct: 680 ENQKSKWKDSLNKVVHAYNCTRNDSTGFSPFYLLYGRSPRLP 721


>SB_9750| Best HMM Match : rve (HMM E-Value=1.2e-37)
          Length = 280

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 43/102 (42%), Positives = 60/102 (58%), Gaps = 1/102 (0%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P  I  DQG  F +++ K LE+L G+ H   +PYHPQ+ G +ER + TL   LR+ + 
Sbjct: 95  GFPLRIHHDQGKEFENDLHKHLEKLSGVAHSRTTPYHPQSNGQVERFNQTLLAMLRT-LP 153

Query: 643 ENQHT-WDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           ENQ + W   L   + AYN   + +TGFSP  LL+G  P +P
Sbjct: 154 ENQKSKWKDSLNKVVHAYNCTRNDSTGFSPFYLLYGRSPRLP 195


>SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 1623

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 43/102 (42%), Positives = 60/102 (58%), Gaps = 1/102 (0%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P  I  DQG  F +++ K LE+L G+ H   +PYHPQ+ G +ER + TL   LR+ + 
Sbjct: 1438 GFPLRIHHDQGKEFENDLHKHLEKLSGVAHSRTTPYHPQSNGQVERFNQTLLAMLRT-LP 1496

Query: 643  ENQHT-WDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            ENQ + W   L   + AYN   + +TGFSP  LL+G  P +P
Sbjct: 1497 ENQKSKWKDSLNKVVHAYNCTRNDSTGFSPFYLLYGRSPRLP 1538


>SB_38577| Best HMM Match : rve (HMM E-Value=2.4e-24)
          Length = 205

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 40/101 (39%), Positives = 56/101 (55%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P  I  DQG  F +++ K LE+L G+ H   +PYHPQ+ G +ER + TL   LR+   
Sbjct: 47  GFPLRIHHDQGKEFENDLHKHLEKLSGVAHSRTTPYHPQSNGQVERFNQTLLAMLRTLPE 106

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
             +  W   L   + AYN   + +TGFSP  LL+G  P +P
Sbjct: 107 NQKSNWKDSLNKVVHAYNCTRNDSTGFSPFYLLYGRSPRLP 147


>SB_55817| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 980

 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 39/105 (37%), Positives = 60/105 (57%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           +G P     DQG    +E++K+LE+L G++H   +PYHP+  G +ER + TL   LR+  
Sbjct: 342 LGFPSSFHHDQGKELENELLKELEKLCGVRHSRTTPYHPEGNGQVERFNRTLLAMLRTLP 401

Query: 646 VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
            + +  W  +L   + AYN   H +TG++P   LFG  P+IP  I
Sbjct: 402 EKFKSRWKDHLNKMVFAYNCTRHDSTGYAPYS-LFGRTPHIPIDI 445


>SB_47545| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 406

 Score = 80.2 bits (189), Expect = 2e-15
 Identities = 39/98 (39%), Positives = 59/98 (60%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP+II +DQ  +F +E++K+L  + G+K    +PYH Q  G  ER + TL E LR+   
Sbjct: 128 GIPQIIHSDQEHSFEAEIVKELCSVHGLKKSKTTPYHTQGNGLCERLNRTLHELLRTLPP 187

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
           + +  W  +LR    AYN+  HSTTG+SP  +++   P
Sbjct: 188 DKKRRWPDHLRQLCFAYNATSHSTTGYSPFFVMYERDP 225


>SB_22156| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1551

 Score = 79.0 bits (186), Expect = 4e-15
 Identities = 42/102 (41%), Positives = 59/102 (57%), Gaps = 1/102 (0%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P  I  DQG  F +++ K LE+L G+ H   +PYHPQ+ G +ER + TL   LR+ + 
Sbjct: 321 GFPLRIHHDQGKEFENDLHKHLEKLSGVAHSRTTPYHPQSNGQVERFNQTLLAMLRT-LP 379

Query: 643 ENQHT-WDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           ENQ + W   L   +  YN   + +TGFSP  LL+G  P +P
Sbjct: 380 ENQKSKWKDSLNKVVHPYNCTRNDSTGFSPFYLLYGRSPRLP 421



 Score = 32.7 bits (71), Expect = 0.37
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCG 698
            GIP  + +D G  F+S+  +      GI+H    PY PQ+ G
Sbjct: 1314 GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNG 1355


>SB_54838| Best HMM Match : Vitellogenin_N (HMM E-Value=4.76441e-44)
          Length = 2581

 Score = 79.0 bits (186), Expect = 4e-15
 Identities = 46/119 (38%), Positives = 64/119 (53%)
 Frame = -1

Query: 793 GANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYL 614
           GA F + + K LE+L G+ H   +PYHPQ  G +ER + TL   +R+     +  W  ++
Sbjct: 2   GAEFENNLFKHLEKLTGVMHSRTTPYHPQGNGLVERMNRTLLGMMRTLPEMYKSNWKDHV 61

Query: 613 RTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYIRALNHRLYYSRQK 437
              + AYN   H TTGF+P +LL G  P +P  ID L     SD  +A +H  YY R K
Sbjct: 62  HKLVHAYNCTKHETTGFAPFKLLLGRSPRLP--ID-LMFGLDSDKDKA-SHSEYYKRWK 116


>SB_46540| Best HMM Match : RVT_1 (HMM E-Value=4.8e-27)
          Length = 751

 Score = 78.6 bits (185), Expect = 6e-15
 Identities = 46/133 (34%), Positives = 72/133 (54%), Gaps = 5/133 (3%)
 Frame = -1

Query: 802 TDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWD 623
           +DQG +F S +++ L RL  ++    +PYHPQ  G  ER + TL   L +  V+ ++ W 
Sbjct: 484 SDQGRDFESRLLRDLCRLGNVEKSRTTPYHPQGNGQTERFNRTLLNMLGTMEVDKKNDWP 543

Query: 622 LYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI----DSL-DLNTYSDYIRALNHR 458
            Y+   + AYN+  HSTTG+SP  L+FG    +P+ +    D + D   Y+ Y   L  +
Sbjct: 544 DYVAGLVHAYNATKHSTTGYSPSYLMFGRNRRLPQDVTLGPDPVHDPQPYAAYKEDLRDK 603

Query: 457 LYYSRQKALQNIE 419
           L  +  +A Q IE
Sbjct: 604 LTDAYSRAQQEIE 616


>SB_16055| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 848

 Score = 75.8 bits (178), Expect = 4e-14
 Identities = 36/104 (34%), Positives = 63/104 (60%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+ + +DQGAN +S+ ++++ +   +     +P+HPQ+ GA ERS  T+   L   + 
Sbjct: 595 GAPEKLHSDQGANLNSQNIEEICQYLKVLKTRTTPFHPQSDGASERSIRTVNAMLAKVVS 654

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
           ++Q  WDLYL +  LAYN+ + S+TG +   L FG +  +P ++
Sbjct: 655 DDQKNWDLYLSSTCLAYNTAVQSSTGHTLSYLEFGRELRLPTAL 698


>SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2028

 Score = 75.4 bits (177), Expect = 5e-14
 Identities = 44/136 (32%), Positives = 69/136 (50%), Gaps = 6/136 (4%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P+ + +DQG +F S V++ L  L GI     +PYHPQ     ER + TL + L +   
Sbjct: 1089 GFPRRLHSDQGRDFESNVIRDLCLLAGITKSRTTPYHPQGNAQTERFNRTLLDMLGTLDG 1148

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI------DSLDLNTYSD 482
            + + +W  Y+ +   AYN   H TT +SP  L+FG  P +P  +      +     + S 
Sbjct: 1149 DKKSSWPEYVSSMAHAYNCTRHQTTKYSPYFLMFGRHPKLPIDVTLGVASEIAPTKSLSS 1208

Query: 481  YIRALNHRLYYSRQKA 434
            Y+ +L  RL Y+ + A
Sbjct: 1209 YVESLRARLDYAYKLA 1224


>SB_21678| Best HMM Match : rve (HMM E-Value=2e-36)
          Length = 350

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 44/136 (32%), Positives = 68/136 (50%), Gaps = 6/136 (4%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+ + +DQG +F S V++ L  L GI     +PYHPQ     ER + TL   L +   
Sbjct: 94  GFPRRLHSDQGRDFESNVIRDLCLLAGITKSRTTPYHPQGNAQTERFNRTLLNMLGTLDE 153

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI------DSLDLNTYSD 482
           + + +W  Y+ +   AYN   H TT +SP  L+FG  P +P  +      +     + S 
Sbjct: 154 DKKSSWPEYVSSMAHAYNCTRHQTTKYSPYFLMFGRHPKLPIDVTLGVASEIAPTKSLSS 213

Query: 481 YIRALNHRLYYSRQKA 434
           Y+ +L  RL Y+ + A
Sbjct: 214 YVESLRARLDYAYKLA 229


>SB_17283| Best HMM Match : rve (HMM E-Value=2.5e-35)
          Length = 316

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 35/93 (37%), Positives = 50/93 (53%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ +++D G  F S    +  R  GIKH    PYHPQ+ GA ERS   +KE L   ++
Sbjct: 52  GLPEEVVSDNGPQFVSYEFVEFMRKNGIKHTLVPPYHPQSNGAAERSVRVVKEALLKQVI 111

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
           +        L + +  Y +  HSTTG SP EL+
Sbjct: 112 QGSQAGHRALASFLFRYRTTPHSTTGMSPAELM 144


>SB_14775| Best HMM Match : rve (HMM E-Value=6.6e-15)
          Length = 167

 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 37/99 (37%), Positives = 54/99 (54%), Gaps = 4/99 (4%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLE----RLFGIKHIFASPYHPQTCGALERSHSTLKEYLR 656
           G+P+ I+TDQG+N         +    R FG+K +  +PYH +T G  ER + TLK  L+
Sbjct: 67  GVPEEILTDQGSNCQGSNCLICQSCWLRNFGVKSLRTTPYHLETDGLCERFNDTLKNMLK 126

Query: 655 SYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
               ++   WD  L   +LAY+     +TGFS  ELL+G
Sbjct: 127 KAAADDTRNWDKMLPYLLLAYHEVPSESTGFSQFELLYG 165


>SB_48097| Best HMM Match : rve (HMM E-Value=2.6e-17)
          Length = 169

 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 36/101 (35%), Positives = 50/101 (49%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P  I  D+G  F + +  QL ++ G+     +PYHP   G +ER + TL   L+  I+
Sbjct: 47  GFPSRIHYDEGREFENNLFHQLHKVSGVSKSRTTPYHPMGNGKVERMNRTLLSMLK--IL 104

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
                WD  L   + AYN   H  TG+SP  L FG  P +P
Sbjct: 105 PETRKWDESLNKMIHAYNCTRHEATGYSPYFLFFGRTPRLP 145


>SB_11123| Best HMM Match : RVT_1 (HMM E-Value=3.4e-27)
          Length = 1154

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 35/97 (36%), Positives = 53/97 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P+++++D G+NF+SE      R  GI H   +PYHP + G  ER+   +++ L   + 
Sbjct: 854  GFPEVVVSDNGSNFTSEEFATFMRQNGIIHKTTAPYHPASNGLAERAVQLIEDGL---LK 910

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            E  HT    L+  +  Y    H+TTG SP E+L G K
Sbjct: 911  EPGHTMATNLQWLLFRYRMTPHTTTGRSPAEMLMGRK 947


>SB_52193| Best HMM Match : rve (HMM E-Value=5.8e-20)
          Length = 353

 Score = 66.1 bits (154), Expect = 3e-11
 Identities = 34/95 (35%), Positives = 48/95 (50%), Gaps = 2/95 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ +++D G  F S    +     GIKH    PYHPQ+ GA ERS   +KE L   ++
Sbjct: 145 GLPEEVVSDNGPQFVSYEFAEFMHTNGIKHTLVPPYHPQSNGAAERSVRVVKEALLKQVI 204

Query: 643 ENQHTWDLYLRTA--MLAYNSNIHSTTGFSPLELL 545
           +      +  R A  +  Y    H TTG SP EL+
Sbjct: 205 QGTKGMSMKHRLANFLFRYRITPHRTTGMSPAELM 239


>SB_8975| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1002

 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 38/101 (37%), Positives = 55/101 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  + +DQG NF S+V   LE    + HI       QT    ER   TLK+YL  +  
Sbjct: 894  GVPFELHSDQGRNFESQVF--LEVCKPLLHI-----QSQTAW-FERYKGTLKDYLAKFTS 945

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
             NQ TWD  +  A+LAY S ++  TG++P  ++FG +  +P
Sbjct: 946  ANQQTWDRDVPLALLAYRSAVYEATGYTPACMMFGRELRLP 986


>SB_20138| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 860

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 27/58 (46%), Positives = 38/58 (65%)
 Frame = -1

Query: 712 PQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           P++ GA ERS  T+   L   + ++Q  WDLYL T  LAYN+ +HS+TG++P  L FG
Sbjct: 661 PESDGASERSIRTVNAMLAKVVSDDQKNWDLYLSTTCLAYNTAVHSSTGYTPSYLEFG 718


>SB_14976| Best HMM Match : rve (HMM E-Value=1.3e-38)
          Length = 1172

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 38/124 (30%), Positives = 60/124 (48%), Gaps = 2/124 (1%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 994  GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 1053

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
            +  + W   L   +  Y +  H+TTG SP ELL G   +  +P      D  T S++   
Sbjct: 1054 QG-NDWKKALDDFLFQYRTTNHATTGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHK 1112

Query: 469  LNHR 458
            L  R
Sbjct: 1113 LRDR 1116


>SB_45349| Best HMM Match : rve (HMM E-Value=6.1e-31)
          Length = 298

 Score = 60.5 bits (140), Expect = 2e-09
 Identities = 36/93 (38%), Positives = 51/93 (54%)
 Frame = -1

Query: 817 PKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
           P  I +D G+ F SE   +  R  GI+H  + P  PQ  G +ER + TL + L+   VE 
Sbjct: 92  PHSIKSDNGSQFVSEEFTRYLRECGIEHRTSPPLWPQANGEVERQNRTLLKALKIAAVEG 151

Query: 637 QHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           ++ W   L T +LAY S   +TTG +P  L+FG
Sbjct: 152 KN-WRNELPTFLLAYRSTPQATTGATPAILMFG 183


>SB_31673| Best HMM Match : rve (HMM E-Value=6.7e-30)
          Length = 426

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 36/95 (37%), Positives = 51/95 (53%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P  I +D G+ F SE   +  R  GI+H  + P  PQ  G +ER +  L + L+   V
Sbjct: 319 GFPYSIKSDNGSQFVSEEFTRYLRECGIEHRTSPPLWPQANGEVERQNRLLLKALKIAAV 378

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           E ++ W   L T +LAY S   +TTG +P  L+FG
Sbjct: 379 EGKN-WRNELPTFLLAYRSTPQATTGATPAFLMFG 412


>SB_3512| Best HMM Match : rve (HMM E-Value=4.7e-35)
          Length = 1073

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 494 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 553

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 554 EKENL-DTKLSRFLLSYRTTPHATTGKTPSELLMNRK 589


>SB_27863| Best HMM Match : rve (HMM E-Value=4.7e-35)
          Length = 742

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 105 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 164

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 165 EKENL-DTKLSRFLLSYRTTPHATTGKTPSELLMNRK 200


>SB_27381| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1392

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 777  GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 836

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 837  EKENL-DTKLSRFLLSYRTTPHATTGKTPSELLMNRK 872


>SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 1772

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 36/107 (33%), Positives = 54/107 (50%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 337 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 396

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSL 503
           E ++  D  L   +L+Y +  H+TTG +P ELL   K      +D++
Sbjct: 397 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRKLKTRLDLDTI 442


>SB_8339| Best HMM Match : rve (HMM E-Value=5.4e-31)
          Length = 351

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP ++++D G N  SE +       GI+HI  +P HP + G  ER+  T+KE +     
Sbjct: 89  GIPDVVVSDNGPNLISEELSAFFSKNGIQHIPVAPLHPSSNGQAERTVQTVKEGIERASG 148

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            +  T    L+  +  Y    H+TTG SP ELL G K
Sbjct: 149 RDLTT---KLQRFLFQYRVTPHTTTGRSPAELLNGRK 182


>SB_35785| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1089

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP ++++D G N  SE +       GI+HI  +P HP + G  ER+  T+KE +     
Sbjct: 838  GIPDVVVSDNGPNLISEELSTFFSKNGIQHIPVAPVHPSSNGQAERTVQTVKEGIERASG 897

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
             +  T    L+  +  Y    H+TTG SP ELL G K
Sbjct: 898  RDLTT---KLQRFLFQYRVTPHTTTGRSPAELLNGRK 931


>SB_19168| Best HMM Match : rve (HMM E-Value=3.9e-38)
          Length = 586

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 42/139 (30%), Positives = 65/139 (46%), Gaps = 4/139 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 181 GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 240

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
           +  + W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   
Sbjct: 241 QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHK 299

Query: 469 LNHR--LYYSRQKALQNIE 419
           L  R  L   RQK    +E
Sbjct: 300 LRDRDALSKLRQKEYAMLE 318



 Score = 37.5 bits (83), Expect = 0.013
 Identities = 19/57 (33%), Positives = 33/57 (57%)
 Frame = -1

Query: 709 QTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           Q  G +ER++ T+++ L+   VE       + R  ++AY S  H++TG +P  L+FG
Sbjct: 358 QANGLVERTNRTIEKILKIATVEKNDLQKEF-RKFLVAYRSTPHTSTGCTPFSLMFG 413


>SB_56941| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1034

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 541 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 600

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 601 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 636


>SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 1671

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 1054 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 1113

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 1114 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 1149


>SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1829

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP ++++D G N  SE +       GI+HI  +P HP + G  ER+  T+KE +     
Sbjct: 1567 GIPDVVVSDNGPNLISEELSTFFSKNGIQHIPVAPLHPSSNGQAERTVQTVKEGIERTPG 1626

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
             +  T    L+  +  Y    H+TTG SP ELL G K
Sbjct: 1627 RDLTT---KLQRFLFQYRVTPHTTTGRSPAELLNGRK 1660


>SB_33992| Best HMM Match : rve (HMM E-Value=6e-35)
          Length = 285

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 120 GLPDIIVSDNATAFIGEKFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 179

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 180 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 215


>SB_30312| Best HMM Match : rve (HMM E-Value=5.6e-15)
          Length = 385

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP ++++D G N  SE +       GI+HI  +P HP + G  ER+  T+KE +     
Sbjct: 129 GIPDVVVSDNGPNLISEELSTFFSKNGIQHIPVAPVHPSSNGQAERTVQTVKEGIERTPG 188

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            +  T    L+  +  Y    H+TTG SP ELL G K
Sbjct: 189 RDLTT---KLQRFLFQYRVTPHTTTGRSPAELLNGRK 222


>SB_29251| Best HMM Match : rve (HMM E-Value=2.3e-29)
          Length = 324

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 3/102 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK I+ D G  FS+ ++        IK    SP  P T G +ERS+ T KE +R+ ++
Sbjct: 222 GFPKKIVCDNGTEFSNAMLNSFCEENNIKICHGSPRTPTTQGLVERSNRTWKEDMRAILI 281

Query: 643 ENQHTWDLYLRTAMLA-YNSNI--HSTTGFSPLELLFGFKPY 527
             Q +   + +  M A Y  NI  H     SP E +FGFK +
Sbjct: 282 SKQKSVGEWCKATMEASYTMNITYHRAIKCSPYEAVFGFKAH 323


>SB_24596| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1907

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 679 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 738

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 739 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 774


>SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43)
          Length = 1602

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 991  GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 1050

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 1051 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 1086


>SB_9298| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 1514

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 1032 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 1091

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 1092 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 1127


>SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30)
          Length = 1280

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP ++++D G N  SE +       GI+HI  +P HP + G  ER+  T+KE +     
Sbjct: 878  GIPDVVVSDNGPNLISEELSTFFSKNGIQHIPVAPVHPSSNGQAERTVQTVKEGIERTPG 937

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
             +  T    L+  +  Y    H+TTG SP ELL G K
Sbjct: 938  RDLTT---KLQRFLFQYRVTPHTTTGRSPAELLNGRK 971


>SB_55004| Best HMM Match : rve (HMM E-Value=8.7e-30)
          Length = 682

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP ++++D G N  SE +       GI+HI  +P HP + G  ER+  T+KE +     
Sbjct: 420 GIPDVVVSDNGPNLISEELSTFFSKNGIQHIPVAPVHPSSNGQAERTVQTVKEGIERTPG 479

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            +  T    L+  +  Y    H+TTG SP ELL G K
Sbjct: 480 RDLTT---KLQRFLFQYRVTPHTTTGRSPAELLNGRK 513


>SB_54590| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 1309

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 1044 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 1103

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 1104 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 1139


>SB_51753| Best HMM Match : rve (HMM E-Value=8.7e-30)
          Length = 378

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP ++++D G N  SE +       GI+HI  +P HP + G  ER+  T+KE +     
Sbjct: 244 GIPDVVVSDNGPNLISEELSTFFSKNGIQHIPVAPVHPSSNGQAERTVQTVKEGIERTPG 303

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            +  T    L+  +  Y    H+TTG SP ELL G K
Sbjct: 304 RDLTT---KLQRFLFQYRVTPHTTTGRSPAELLNGRK 337


>SB_46176| Best HMM Match : rve (HMM E-Value=8.7e-30)
          Length = 378

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP ++++D G N  SE +       GI+HI  +P HP + G  ER+  T+KE +     
Sbjct: 244 GIPDVVVSDNGPNLISEELSTFFSKNGIQHIPVAPVHPSSNGQAERTVQTVKEGIERTPG 303

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            +  T    L+  +  Y    H+TTG SP ELL G K
Sbjct: 304 RDLTT---KLQRFLFQYRVTPHTTTGRSPAELLNGRK 337


>SB_45153| Best HMM Match : rve (HMM E-Value=0)
          Length = 2264

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 1969 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 2028

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 2029 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 2064



 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 34/97 (35%), Positives = 49/97 (50%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 953  GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 1012

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            E ++  D  L   +L+Y +  H+ TG +P ELL   K
Sbjct: 1013 EKENL-DTKLSRFLLSYRTTPHANTGKTPGELLMNRK 1048


>SB_39379| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 285

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 120 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 179

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 180 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 215


>SB_30480| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 302

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 196 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 255

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 256 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 291


>SB_29849| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 494

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 318 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 377

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 378 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 413


>SB_25999| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 419

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 196 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 255

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 256 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 291


>SB_24280| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1351

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 1035 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 1094

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 1095 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 1130


>SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29)
          Length = 1544

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP ++++D G N  SE +       GI+HI  +P HP + G  ER+  T+KE +     
Sbjct: 1035 GIPDVVVSDNGPNLISEELSTFFSKNGIQHIPVAPLHPSSNGQAERTVQTVKEGIERTPG 1094

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
             +  T    L+  +  Y    H+TTG SP ELL G K
Sbjct: 1095 RDLTT---KLQRFLFQYRVTPHTTTGRSPAELLNGRK 1128


>SB_12609| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 623

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 458 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 517

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 518 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 553


>SB_9355| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 1520

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 1257 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 1316

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 1317 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 1352


>SB_6912| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 440

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 161 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 220

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 221 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 256


>SB_5291| Best HMM Match : rve (HMM E-Value=2.3e-35)
          Length = 426

 Score = 59.3 bits (137), Expect = 4e-09
 Identities = 35/97 (36%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 161 GLPDIIVSDNATAFVGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 220

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 221 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 256


>SB_50945| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 896

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 553 GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 612

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
           +  + W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   
Sbjct: 613 QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHK 671

Query: 469 LNHR 458
           L  R
Sbjct: 672 LRDR 675


>SB_49359| Best HMM Match : rve (HMM E-Value=5.5e-37)
          Length = 971

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 764  GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 823

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
            +  + W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   
Sbjct: 824  QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHK 882

Query: 469  LNHR 458
            L  R
Sbjct: 883  LRDR 886


>SB_40370| Best HMM Match : rve (HMM E-Value=1.3e-37)
          Length = 1393

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 1124 GIPYTVRSDNGLPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 1183

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
            +  + W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   
Sbjct: 1184 QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHK 1242

Query: 469  LNHR 458
            L  R
Sbjct: 1243 LRDR 1246


>SB_36737| Best HMM Match : rve (HMM E-Value=1.4e-38)
          Length = 358

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 89  GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 148

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
           +  + W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   
Sbjct: 149 QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHK 207

Query: 469 LNHR 458
           L  R
Sbjct: 208 LRDR 211


>SB_28729| Best HMM Match : rve (HMM E-Value=1.4e-38)
          Length = 374

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 105 GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 164

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
           +  + W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   
Sbjct: 165 QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVEIPKDRATESEWQHK 223

Query: 469 LNHR 458
           L  R
Sbjct: 224 LRDR 227


>SB_14178| Best HMM Match : rve (HMM E-Value=1.4e-38)
          Length = 283

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 105 GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 164

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
           +  + W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   
Sbjct: 165 QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHK 223

Query: 469 LNHR 458
           L  R
Sbjct: 224 LRDR 227


>SB_42915| Best HMM Match : rve (HMM E-Value=1.4e-38)
          Length = 610

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 341 GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 400

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
           +  + W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   
Sbjct: 401 QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHK 459

Query: 469 LNHR 458
           L  R
Sbjct: 460 LRDR 463


>SB_39602| Best HMM Match : rve (HMM E-Value=1.4e-38)
          Length = 523

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 357 GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 416

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
           +  + W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   
Sbjct: 417 QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHK 475

Query: 469 LNHR 458
           L  R
Sbjct: 476 LRDR 479


>SB_31504| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 767

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 498 GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 557

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
           +  + W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   
Sbjct: 558 QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHK 616

Query: 469 LNHR 458
           L  R
Sbjct: 617 LRDR 620


>SB_16657| Best HMM Match : RVT_1 (HMM E-Value=6.4e-18)
          Length = 1138

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 869  GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 928

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
            +  + W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   
Sbjct: 929  QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHK 987

Query: 469  LNHR 458
            L  R
Sbjct: 988  LRDR 991


>SB_4255| Best HMM Match : rve (HMM E-Value=1.4e-38)
          Length = 899

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 630 GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 689

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
           +  + W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   
Sbjct: 690 QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHK 748

Query: 469 LNHR 458
           L  R
Sbjct: 749 LRDR 752


>SB_3392| Best HMM Match : rve (HMM E-Value=1.4e-38)
          Length = 374

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 105 GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 164

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
           +  + W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   
Sbjct: 165 QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVEIPKDRATESEWQHK 223

Query: 469 LNHR 458
           L  R
Sbjct: 224 LRDR 227


>SB_15656| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1107

 Score = 58.4 bits (135), Expect = 7e-09
 Identities = 31/95 (32%), Positives = 49/95 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 866  GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 925

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            +  + W   L   +  Y +  H+ TG SP ELL G
Sbjct: 926  QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMG 959


>SB_41743| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1436

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 30/107 (28%), Positives = 51/107 (47%), Gaps = 5/107 (4%)
 Frame = -1

Query: 778  SEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAML 599
            + +  QL ++ G+     +PYH    G +ER + T    L++     +  WD  L   + 
Sbjct: 966  TNLFHQLHKISGVSKSRTTPYHQMGNGKVERMNRTFLSMLKTLPETRKSKWDESLNKMIH 1025

Query: 598  AYNSNIHSTTGFSPLELLFGFKPYIPKSI-----DSLDLNTYSDYIR 473
             YN   H  TG+SP  LLFG  P++P  +        ++ +Y++Y R
Sbjct: 1026 GYNCTRHKATGYSPYFLLFGRTPWLPIDLLFDLKPEKNVESYTEYAR 1072


>SB_20314| Best HMM Match : RVT_1 (HMM E-Value=1e-32)
          Length = 1556

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 34/97 (35%), Positives = 50/97 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P II++D    F  +         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 1291 GLPDIIVSDNATAFIGKEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 1350

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 1351 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 1386


>SB_39760| Best HMM Match : rve (HMM E-Value=1.1e-29)
          Length = 634

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 34/97 (35%), Positives = 50/97 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T K+ ++    
Sbjct: 333 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKKTMKKMGG 392

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 393 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 428


>SB_59085| Best HMM Match : rve (HMM E-Value=0.00048)
          Length = 276

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 36/124 (29%), Positives = 58/124 (46%), Gaps = 2/124 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 7   GTPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 66

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
           +  + W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   
Sbjct: 67  QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHK 125

Query: 469 LNHR 458
           L  R
Sbjct: 126 LRDR 129


>SB_48772| Best HMM Match : rve (HMM E-Value=4.2e-35)
          Length = 494

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 36/124 (29%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  + ++ G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 316 GIPYTVRSNNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANL 375

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRA 470
           +  + W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   
Sbjct: 376 QG-NDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHK 434

Query: 469 LNHR 458
           L  R
Sbjct: 435 LRDR 438


>SB_59677| Best HMM Match : RVT_1 (HMM E-Value=2.1e-28)
          Length = 1159

 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 32/94 (34%), Positives = 51/94 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  II+D G  F S   +Q    +GI+H+ +SP + Q+ G +E +  T K  ++    
Sbjct: 896  GIPDQIISDNGPPFESHEFRQFTNSYGIEHVTSSPGYVQSNGKVENAIKTAKNLMKKATE 955

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF 542
             N+   D YL  A+L + +    T G+SP++ LF
Sbjct: 956  SNK---DPYL--ALLDWRNTPSETVGYSPVQRLF 984


>SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3297

 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 3/102 (2%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK I+ D G  FS+ ++        +K    SP  P T G +ERS+ T KE +R+ ++
Sbjct: 944  GFPKKIVCDNGTEFSNAMLNSFCEENTLKICHGSPRTPTTQGLVERSNCTWKEDMRAILI 1003

Query: 643  ENQHTWDLYLRTAMLA-YNSNI--HSTTGFSPLELLFGFKPY 527
              Q +   + +  M A Y  NI  H     SP + +FGFK +
Sbjct: 1004 SKQKSVGEWCKATMEASYTMNITYHRAIKCSPYQAVFGFKAH 1045


>SB_30319| Best HMM Match : rve (HMM E-Value=1.2e-37)
          Length = 255

 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 30/95 (31%), Positives = 48/95 (50%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   +
Sbjct: 105 GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKEIPYWPQSNGEVERCNRTILKVIRIANL 164

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           +  + W   L   +  Y +  H+ TG SP E L G
Sbjct: 165 QG-NDWKKALDDFLFQYRTTNHAATGCSPAEFLMG 198


>SB_2192| Best HMM Match : rve (HMM E-Value=4e-23)
          Length = 491

 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 3/102 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK I+ D G  FS+ ++        +K    SP  P T G +ERS+ T KE +R+ ++
Sbjct: 214 GFPKKIVCDNGTEFSNAMLNSFCEENTLKICHGSPRTPTTQGLVERSNCTWKEDMRAILI 273

Query: 643 ENQHTWDLYLRTAMLA-YNSNI--HSTTGFSPLELLFGFKPY 527
             Q +   + +  M A Y  NI  H     SP + +FGFK +
Sbjct: 274 SKQKSVGEWCKATMEASYTMNITYHRAIKCSPYQAVFGFKAH 315


>SB_51339| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 406

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 29/95 (30%), Positives = 53/95 (55%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+ + +D G  F+S   +   +  GIK +  +P  PQ  G ++R++ T+++ L+   V
Sbjct: 203 GYPEALRSDIGPQFTSVEFEAYLKSNGIKWVSTTPLWPQASGLVDRTNRTIEKILKIATV 262

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           E +     + R  ++AY S  H++TG +P  L+FG
Sbjct: 263 EKKDLQKEF-RKFLVAYRSTPHTSTGCTPFSLMFG 296


>SB_47959| Best HMM Match : rve (HMM E-Value=3e-29)
          Length = 622

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 3/102 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK I+ D G  FS+ ++        IK    S   P T G +ERS+ T KE +R+ ++
Sbjct: 303 GFPKKIVCDNGTEFSNAMLNSFCEENNIKICHGSARTPTTQGLVERSNRTWKEDMRAILI 362

Query: 643 ENQHTWDLYLRTAMLA-YNSNI--HSTTGFSPLELLFGFKPY 527
             Q +   + +  M A Y  NI  H     SP E +FGFK +
Sbjct: 363 SKQKSVGEWCKATMEASYTMNITYHRAIKCSPYEAVFGFKAH 404


>SB_34135| Best HMM Match : rve (HMM E-Value=3e-29)
          Length = 324

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 3/102 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK I+ D G  FS+ ++        IK    S   P T G +ERS+ T KE +R+ ++
Sbjct: 222 GFPKKIVCDNGTEFSNAMLNSFCEENNIKICHGSARTPTTQGLVERSNRTWKEDMRAILI 281

Query: 643 ENQHTWDLYLRTAMLA-YNSNI--HSTTGFSPLELLFGFKPY 527
             Q +   + +  M A Y  NI  H     SP E +FGFK +
Sbjct: 282 SKQKSVGEWCKATMEASYTMNITYHRAIKCSPYEAVFGFKAH 323


>SB_26192| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 777

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 34/97 (35%), Positives = 49/97 (50%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP +    ER   T KE ++    
Sbjct: 196 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNEFAERYVRTFKETMKKMGG 255

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 256 EKENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 291


>SB_55915| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 321

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 34/101 (33%), Positives = 46/101 (45%), Gaps = 4/101 (3%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK +ITD G  F + +++      GI+    SP  P T G +ERS+ T KE LR+ + 
Sbjct: 24  GYPKKLITDNGLEFKNRLVEAFAEKNGIQISHGSPRMPTTQGLVERSNRTFKEDLRAILQ 83

Query: 643 ENQH----TWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
              H     W      A    N   H     +P E +FGFK
Sbjct: 84  SEAHKEMKRWCESTSQASYTMNITHHRAMNETPYEAVFGFK 124


>SB_54416| Best HMM Match : rve (HMM E-Value=1.4e-27)
          Length = 1068

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 3/102 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK I+ D G  FS+ ++        IK    S   P T G +ERS+ T KE +R+ ++
Sbjct: 403 GFPKKIVCDNGTEFSNAMLNSFCEENNIKICHGSARTPTTQGLVERSNRTWKEDMRAILI 462

Query: 643 ENQHTWDLYLRTAMLA-YNSNI--HSTTGFSPLELLFGFKPY 527
             Q +   + +  M A Y  NI  H     SP E +FGFK +
Sbjct: 463 SKQKSVGEWCKATMEASYTMNITYHRAIKCSPYEAVFGFKAH 504


>SB_13256| Best HMM Match : rve (HMM E-Value=1.1e-17)
          Length = 321

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 34/101 (33%), Positives = 46/101 (45%), Gaps = 4/101 (3%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK +ITD G  F + +++      GI+    SP  P T G +ERS+ T KE LR+ + 
Sbjct: 90  GYPKKLITDNGLEFKNRLVEAFAEKNGIQISHGSPRMPTTQGLVERSNRTFKEDLRAILQ 149

Query: 643 ENQH----TWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
              H     W      A    N   H     +P E +FGFK
Sbjct: 150 SEAHKEMKRWCESTSQASYTMNITHHRAMNETPYEAVFGFK 190


>SB_58283| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 417

 Score = 55.6 bits (128), Expect = 5e-08
 Identities = 29/95 (30%), Positives = 51/95 (53%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+ + +D G  F+S   +   +  GIK +  +P  PQ  G +ER++ T+++ L+   V
Sbjct: 214 GYPEALRSDNGPQFTSVEFEAYLKSNGIKWVSTTPLWPQANGLVERTNRTIEKILKIATV 273

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           E +       R  ++AY    H++TG +P  L+FG
Sbjct: 274 EKKDL-QTEFRKFLVAYRPTPHTSTGCTPFSLMFG 307


>SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37)
          Length = 732

 Score = 55.6 bits (128), Expect = 5e-08
 Identities = 32/92 (34%), Positives = 47/92 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP ++++D G N  SE +       GI+HI  +P HP + G  ER+  T+KE +     
Sbjct: 644 GIPDVVVSDNGPNLISEELSTFFSKNGIQHIPVAPLHPSSNGQAERTVQTVKEGIERTPG 703

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLEL 548
            +  T    L+  +  Y    H+TTG SP EL
Sbjct: 704 RDLTT---KLQRFLFQYRVTPHTTTGRSPAEL 732


>SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3293

 Score = 55.6 bits (128), Expect = 5e-08
 Identities = 31/94 (32%), Positives = 51/94 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  I++D G  F S   +Q    +GI+H+ +SP + Q+ G +E +  T K  ++    
Sbjct: 3050 GIPDQIMSDNGPPFDSHEFRQFTNSYGIEHVTSSPGYAQSNGKVENAIKTAKNLMKKATE 3109

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF 542
             N+   D YL  A+L + +    T G+SP++ LF
Sbjct: 3110 SNK---DPYL--ALLDWRNTPSETVGYSPVQRLF 3138


>SB_49093| Best HMM Match : rve (HMM E-Value=1.5e-17)
          Length = 313

 Score = 55.6 bits (128), Expect = 5e-08
 Identities = 36/103 (34%), Positives = 50/103 (48%), Gaps = 6/103 (5%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK +ITD G  F +  ++      GI+    SP  P T G +ERS+ T KE LR+ + 
Sbjct: 111 GYPKKLITDNGLEFKNRFVEAFAEKNGIQISHGSPRTPTTQGLVERSNRTFKEDLRAILQ 170

Query: 643 ENQH----TWDLYLRTAMLAYNSNI--HSTTGFSPLELLFGFK 533
              H     W     T+ ++Y  NI  H     +P E +FGFK
Sbjct: 171 SEAHKELKRW--CESTSQVSYTMNITHHRAINETPYEAVFGFK 211


>SB_57310| Best HMM Match : rve (HMM E-Value=2.5e-25)
          Length = 440

 Score = 55.6 bits (128), Expect = 5e-08
 Identities = 28/63 (44%), Positives = 39/63 (61%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P  I  DQG  F +++ K LE+L G+ H   +PYHPQ+ G +ER + TL   LR+ + 
Sbjct: 334 GFPLRIHHDQGKEFENDLHKHLEKLSGVAHSRTTPYHPQSNGQVERFNQTLLAMLRT-LP 392

Query: 643 ENQ 635
           ENQ
Sbjct: 393 ENQ 395


>SB_51546| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 420

 Score = 55.6 bits (128), Expect = 5e-08
 Identities = 31/94 (32%), Positives = 51/94 (54%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  I++D G  F S   +Q    +GI+H+ +SP + Q+ G +E +  T K  ++    
Sbjct: 41  GIPDQIMSDNGPPFDSHEFRQFTNSYGIEHVTSSPGYAQSNGKVENAIKTAKNLMKKATE 100

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF 542
            N+   D YL  A+L + +    T G+SP++ LF
Sbjct: 101 SNK---DPYL--ALLDWRNTPSETVGYSPVQRLF 129


>SB_31556| Best HMM Match : rve (HMM E-Value=4.7e-30)
          Length = 322

 Score = 55.6 bits (128), Expect = 5e-08
 Identities = 34/101 (33%), Positives = 45/101 (44%), Gaps = 4/101 (3%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK +ITD G  F + +++      GI+    SP  P T G +ERS+ T KE LR+   
Sbjct: 188 GYPKKLITDNGLEFKNRLVEAFAEKNGIQISHGSPRKPTTQGLVERSNRTFKEDLRAIFQ 247

Query: 643 ENQH----TWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
              H     W      A    N   H     +P E +FGFK
Sbjct: 248 SEAHKELKRWCESTSQASYTMNITHHRAINETPYEAVFGFK 288


>SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1017

 Score = 55.6 bits (128), Expect = 5e-08
 Identities = 35/99 (35%), Positives = 56/99 (56%), Gaps = 1/99 (1%)
 Frame = -1

Query: 826  IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
            +GIP I++TD G  F+S    +    +G  HI +SP++ Q+ G  ER+  T+K +L+   
Sbjct: 745  LGIPDILVTDNGPQFASAEFNKFAATWGFDHITSSPWYAQSNGESERAVETIKNFLKK-- 802

Query: 646  VENQHTWDLYLRTAMLAY-NSNIHSTTGFSPLELLFGFK 533
                   D YL  A+L+Y N+ +H+  G+SP +L  G K
Sbjct: 803  -----CDDEYL--ALLSYRNTPLHN--GYSPSQLSMGRK 832


>SB_58163| Best HMM Match : rve (HMM E-Value=9e-32)
          Length = 355

 Score = 55.2 bits (127), Expect = 6e-08
 Identities = 34/97 (35%), Positives = 49/97 (50%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 105 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 164

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           E ++  D  L   +L+  +  H+TTG +P ELL   K
Sbjct: 165 EKENL-DTKLSRFLLSDRTTPHATTGKTPGELLMNRK 200


>SB_39667| Best HMM Match : rve (HMM E-Value=9e-32)
          Length = 1845

 Score = 55.2 bits (127), Expect = 6e-08
 Identities = 34/97 (35%), Positives = 49/97 (50%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 907  GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 966

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
            E ++  D  L   +L+  +  H+TTG +P ELL   K
Sbjct: 967  EKENL-DTKLSRFLLSDRTTPHATTGKTPGELLMNRK 1002


>SB_43121| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)
          Length = 1037

 Score = 54.8 bits (126), Expect = 8e-08
 Identities = 31/89 (34%), Positives = 46/89 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 949  GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 1008

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSP 557
            E ++  D  L   +L+Y +  H+TTG +P
Sbjct: 1009 EKENL-DTKLSRFLLSYRTTPHATTGKTP 1036


>SB_13455| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1387

 Score = 54.8 bits (126), Expect = 8e-08
 Identities = 27/68 (39%), Positives = 39/68 (57%)
 Frame = -1

Query: 742  IKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGF 563
            +K +    Y  + CG  ERS  T+   L   + ++Q  WDLYL +  LAYN+ +HS+TG 
Sbjct: 1106 VKRLNEVVYRIKYCGQ-ERSIRTVNAMLAKVVSDDQKNWDLYLSSTCLAYNTAVHSSTGH 1164

Query: 562  SPLELLFG 539
            +P  L FG
Sbjct: 1165 TPSYLEFG 1172


>SB_8981| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1726

 Score = 54.8 bits (126), Expect = 8e-08
 Identities = 34/119 (28%), Positives = 57/119 (47%), Gaps = 2/119 (1%)
 Frame = -1

Query: 808 IITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHT 629
           +++D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   ++  + 
Sbjct: 86  LLSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANLQG-ND 144

Query: 628 WDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRALNHR 458
           W   L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   L  R
Sbjct: 145 WKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHKLRDR 203


>SB_3438| Best HMM Match : RVT_1 (HMM E-Value=1.3e-30)
          Length = 1405

 Score = 54.8 bits (126), Expect = 8e-08
 Identities = 31/93 (33%), Positives = 56/93 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP ++++D G  F+S + +Q  + +G+ H+ +SP +P+  G +ER+  T+KE L+    
Sbjct: 895  GIPDLVVSDNGPQFASNLYEQFAKNYGLTHVTSSPLYPRANGEVERAVRTVKEILK---- 950

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
            +N+   D YL   +L+Y ++     G +P ELL
Sbjct: 951  KNE---DPYL--GLLSYRTS-PLQNGLAPCELL 977


>SB_54349| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 971

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 28/95 (29%), Positives = 52/95 (54%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P+ + +D G  F+S   +   +  GIK +  +P  PQ  G +ER++  +++ L+   V
Sbjct: 720  GYPEALRSDNGPQFTSVEFEAYLKSNGIKWVSTTPLWPQANGLIERTNRIIEKILKIATV 779

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            E +     + R  ++AY S +H++T  +P  L+FG
Sbjct: 780  EKKDLQKEF-RKFLVAYRSTLHTSTRCTPFSLMFG 813


>SB_49072| Best HMM Match : rve (HMM E-Value=2.7e-29)
          Length = 307

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 29/98 (29%), Positives = 48/98 (48%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ +++D G  F S  +    +  GI+H     YHP + G  ER   TLK+ L +   
Sbjct: 176 GLPEEMVSDNGPPFISSELDMFMKSNGIRHTRVPRYHPASNGEAERYVQTLKQALLTSKF 235

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
           +   +    L + + +Y +  H+ TG +P EL    KP
Sbjct: 236 DQGKSLQQRLSSFLFSYRNTPHTVTGQTPAELFLKRKP 273


>SB_48126| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39)
          Length = 1510

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 29/98 (29%), Positives = 48/98 (48%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ +++D G  F S  +    +  GI+H     YHP + G  ER   TLK+ L +   
Sbjct: 990  GLPEEMVSDNGPPFISSELDMFMKSNGIRHTRVPRYHPASNGEAERYVQTLKQALLTSKF 1049

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            +   +    L + + +Y +  H+ TG +P EL    KP
Sbjct: 1050 DQGKSLQQRLSSFLFSYRNTPHTVTGQTPAELFLKRKP 1087


>SB_47416| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1413

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 29/98 (29%), Positives = 48/98 (48%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ +++D G  F S  +    +  GI+H     YHP + G  ER   TLK+ L +   
Sbjct: 1012 GLPEEMVSDNGPPFISSELDMFMKSNGIRHTRVPRYHPASNGEAERYVQTLKQALLTSKF 1071

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            +   +    L + + +Y +  H+ TG +P EL    KP
Sbjct: 1072 DQGKSLQQRLSSFLFSYRNTPHTVTGQTPAELFLKRKP 1109


>SB_37298| Best HMM Match : rve (HMM E-Value=2.7e-29)
          Length = 350

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 29/98 (29%), Positives = 48/98 (48%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ +++D G  F S  +    +  GI+H     YHP + G  ER   TLK+ L +   
Sbjct: 81  GLPEEMVSDNGPPFISSELDMFMKSNGIRHTRVPRYHPASNGEAERYVQTLKQALLTSKF 140

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
           +   +    L + + +Y +  H+ TG +P EL    KP
Sbjct: 141 DQGKSLQQRLSSFLFSYRNTPHTVTGQTPAELFLKRKP 178


>SB_25140| Best HMM Match : RVT_1 (HMM E-Value=7.8e-38)
          Length = 1425

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 29/98 (29%), Positives = 48/98 (48%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ +++D G  F S  +    +  GI+H     YHP + G  ER   TLK+ L +   
Sbjct: 389 GLPEEMVSDNGPPFISSELDMFMKSNGIRHTRVPRYHPASNGEAERYVQTLKQALLTSKF 448

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
           +   +    L + + +Y +  H+ TG +P EL    KP
Sbjct: 449 DQGKSLQQRLSSFLFSYRNTPHTVTGQTPAELFLKRKP 486


>SB_23893| Best HMM Match : rve (HMM E-Value=3.1e-24)
          Length = 553

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 29/98 (29%), Positives = 48/98 (48%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ +++D G  F S  +    +  GI+H     YHP + G  ER   TLK+ L +   
Sbjct: 284 GLPEEMVSDNGPPFISSELDMFMKSNGIRHTRVPRYHPASNGEAERYVQTLKQALLTSKF 343

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
           +   +    L + + +Y +  H+ TG +P EL    KP
Sbjct: 344 DQGKSLQQRLSSFLFSYRNTPHTVTGQTPAELFLKRKP 381


>SB_51971| Best HMM Match : rve (HMM E-Value=7.7e-31)
          Length = 488

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 29/98 (29%), Positives = 48/98 (48%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ +++D G  F S  +    +  GI+H     YHP + G  ER   TLK+ L +   
Sbjct: 219 GLPEEMVSDNGPPFISSELDMFMKSNGIRHTRVPRYHPASNGEAERYVQTLKQALLTSKF 278

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
           +   +    L + + +Y +  H+ TG +P EL    KP
Sbjct: 279 DQGKSLQQRLSSFLFSYRNTPHTVTGQTPAELFLKRKP 316


>SB_45121| Best HMM Match : rve (HMM E-Value=3.8e-09)
          Length = 1111

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 41/135 (30%), Positives = 68/135 (50%), Gaps = 2/135 (1%)
 Frame = -1

Query: 820  IPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE 641
            IP  I++D G  F S   +Q    +GI+H+ +SP + Q+ G +E +  T K  ++     
Sbjct: 805  IPDQIMSDNGPPFDSHEFRQFTNSYGIEHVISSPGYAQSNGKVENAIKTAKNLMKKATES 864

Query: 640  NQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRAL 467
            N+   D YL  A+L + +    T G+SP++ LF    K  +P S   L  +   D    +
Sbjct: 865  NK---DPYL--ALLDWRNTPSETVGYSPVQRLFNRRTKTLLPTSSRLLKPSVPRD----V 915

Query: 466  NHRLYYSRQKALQNI 422
             H+L  + QKA Q++
Sbjct: 916  RHKL--TLQKARQSL 928


>SB_33948| Best HMM Match : rve (HMM E-Value=2.8e-29)
          Length = 361

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 29/98 (29%), Positives = 48/98 (48%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ +++D G  F S  +    +  GI+H     YHP + G  ER   TLK+ L +   
Sbjct: 230 GLPEEMVSDNGPPFISSELDMFMKSNGIRHTRVPRYHPASNGEAERYVQTLKQALLTSKF 289

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
           +   +    L + + +Y +  H+ TG +P EL    KP
Sbjct: 290 DQGKSLQQRLSSFLFSYRNTPHTVTGQTPAELFLKRKP 327


>SB_29114| Best HMM Match : rve (HMM E-Value=1.9e-23)
          Length = 365

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 30/94 (31%), Positives = 51/94 (54%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  I++D G  F S   +Q    +GI+H+ +SP + Q+ G +E +  T K  ++    
Sbjct: 200 GIPDQIMSDNGPPFDSHEFRQFTNSYGIEHVTSSPGYAQSNGKVENAIKTAKNLMKKATE 259

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF 542
            N+   D YL  A+L + +    T G+SP++ +F
Sbjct: 260 SNK---DPYL--ALLDWRNTPSETVGYSPVQRVF 288


>SB_3471| Best HMM Match : rve (HMM E-Value=2.7e-29)
          Length = 212

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 29/98 (29%), Positives = 48/98 (48%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ +++D G  F S  +    +  GI+H     YHP + G  ER   TLK+ L +   
Sbjct: 81  GLPEEMVSDNGPPFISSELDMFMKSNGIRHTRVPRYHPASNGEAERYVQTLKQALLTSKF 140

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
           +   +    L + + +Y +  H+ TG +P EL    KP
Sbjct: 141 DQGKSLQQRLSSFLFSYRNTPHTVTGQTPAELFLKRKP 178


>SB_48278| Best HMM Match : rve (HMM E-Value=7.1e-28)
          Length = 307

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 29/98 (29%), Positives = 48/98 (48%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ +++D G  F S  +    +  GI+H     YHP + G  ER   TLK+ L +   
Sbjct: 176 GLPEEMVSDNGPPFISSELDMFMKSNGIRHTRVPRYHPASNGEAERYVQTLKQALFTSKF 235

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
           +   +    L + + +Y +  H+ TG +P EL    KP
Sbjct: 236 DQGKSLQQRLSSFLFSYRNTPHTVTGQTPAELFLKRKP 273


>SB_44967| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1284

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 29/98 (29%), Positives = 48/98 (48%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ +++D G  F S  +    +  GI+H     YHP + G  ER   TLK+ L +   
Sbjct: 1015 GLPEEMVSDNGPPFISSELDMFMKSNGIQHTRVPRYHPASNGEAERYVQTLKQALLTSKF 1074

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            +   +    L + + +Y +  H+ TG +P EL    KP
Sbjct: 1075 DRGKSLQQRLSSFLFSYRNTPHTVTGQTPAELFLKRKP 1112


>SB_39528| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1029

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 35/102 (34%), Positives = 49/102 (48%), Gaps = 3/102 (2%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK I  D G  FS+ +         I+    SP  P T G +ERS+ T KE +R+ ++
Sbjct: 774  GFPKKIFCDNGTEFSNAMPDSFCEENNIEICHESPRTPTTQGLVERSNRTWKEDMRAILI 833

Query: 643  ENQHTWDLYLRTAMLA-YNSNI--HSTTGFSPLELLFGFKPY 527
              Q +   + +  M A Y  NI  H     SP E +FGFK +
Sbjct: 834  SKQKSVGEWCKATMEASYTMNITYHRAIKCSPYEAVFGFKAH 875


>SB_37763| Best HMM Match : rve (HMM E-Value=4.2e-27)
          Length = 510

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 40/111 (36%), Positives = 57/111 (51%), Gaps = 3/111 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P I+ +DQG  F   V+K++  +  +  I +S Y PQT G  ERSH T KE +R  ++
Sbjct: 254 GPPLILQSDQGPEFKG-VVKKVCLVLNVIVIKSSAYSPQTQGKDERSHRTWKEKIRFDML 312

Query: 643 ENQH--TWDLYLRTAMLAYNSNIHSTTG-FSPLELLFGFKPYIPKSIDSLD 500
           E +    W   L      YN + HS+ G  SP E+ FG      + + SLD
Sbjct: 313 ECEDGLNWVERLPVYQQLYNESPHSSLGMLSPFEVHFGRPSNRLRQLLSLD 363


>SB_28906| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1191

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 31/94 (32%), Positives = 51/94 (54%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  I++D G  F S   +QL   + I+H+ +SP + Q+ G +E +  T K  ++    
Sbjct: 167 GIPDQIMSDNGPPFDSHEFRQLTNSYRIEHVTSSPGYAQSNGKVENAIKTAKNLMKKATE 226

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF 542
            N+   D YL  A+L + +    T G+SP++ LF
Sbjct: 227 SNK---DPYL--ALLDWRNTPSETVGYSPVQRLF 255


>SB_21743| Best HMM Match : rve (HMM E-Value=4e-17)
          Length = 865

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 40/131 (30%), Positives = 61/131 (46%), Gaps = 5/131 (3%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  +++D G  + S+      +  G  HI +SP++PQ  G +ER+  T K+ LR    
Sbjct: 622 GIPDTVVSDNGPQYVSQEFTNFAKDMGFTHITSSPHYPQANGEVERAVQTAKDILRKN-- 679

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK-----PYIPKSIDSLDLNTYSDY 479
            N H   L  R+A LA         G +P E+L G K     P +P++I    ++     
Sbjct: 680 TNPHLGLLAYRSAPLA--------NGLTPSEILMGRKLRNKLPSVPENIKPRKIDQEQLL 731

Query: 478 IRALNHRLYYS 446
            R   +R  YS
Sbjct: 732 KREQEYRERYS 742


>SB_46895| Best HMM Match : rve (HMM E-Value=1.6e-25)
          Length = 329

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 31/93 (33%), Positives = 55/93 (59%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP ++++D G  F+S + +Q  + +G  H+ +SP +P+  G +ER+  T+KE L+    
Sbjct: 91  GIPDLVVSDNGPQFASNLYEQFAKDYGFTHVTSSPLYPRANGEVERAVRTVKEILK---- 146

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
           +N+   D YL   +L+Y ++     G +P ELL
Sbjct: 147 KNE---DPYL--GLLSYRTS-PLQNGLAPCELL 173


>SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0)
          Length = 2376

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 24/62 (38%), Positives = 37/62 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P     DQG  F +E++K+LE+L G++H   +PYHP+  G +ER + TL   L   + 
Sbjct: 1640 GFPFSFHHDQGKEFENELLKELEKLCGVRHSRTTPYHPEGNGQVERFNRTLLAMLSPPLT 1699

Query: 643  EN 638
            +N
Sbjct: 1700 DN 1701


>SB_23051| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2141

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 35/98 (35%), Positives = 54/98 (55%), Gaps = 1/98 (1%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP I++TD G  F+S    +    +G  HI +SP + Q+ G  ER+  T+K +L+    
Sbjct: 1724 GIPDILVTDNGPQFASAEFNKFAATWGFDHITSSPRYAQSNGESERAVETIKNFLKK--- 1780

Query: 643  ENQHTWDLYLRTAMLAY-NSNIHSTTGFSPLELLFGFK 533
                  D YL  A+L+Y N+ +H+  G+SP +L  G K
Sbjct: 1781 ----CDDEYL--ALLSYRNTPLHN--GYSPSQLSMGRK 1810


>SB_2808| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 314

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 4/101 (3%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK +ITD    F +++++   +  GI+    SP  P   G +ERS+ T KE LR+ + 
Sbjct: 127 GCPKKLITDNWLEFKNQLVEAFPKKNGIQISHGSPRTPTAQGLVERSNRTFKEDLRAILQ 186

Query: 643 ENQH----TWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
              H     W      A    N   H     +P E++FGFK
Sbjct: 187 SEAHKELKRWCESTSQASYTVNITHHRAINETPYEVVFGFK 227


>SB_52251| Best HMM Match : rve (HMM E-Value=1.1e-34)
          Length = 863

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/116 (29%), Positives = 54/116 (46%), Gaps = 2/116 (1%)
 Frame = -1

Query: 799 DQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDL 620
           D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   ++  + W  
Sbjct: 602 DNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANLQG-NDWKK 660

Query: 619 YLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRALNHR 458
            L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   L  R
Sbjct: 661 ALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHKLRDR 716


>SB_45195| Best HMM Match : rve (HMM E-Value=0.56)
          Length = 263

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/116 (29%), Positives = 54/116 (46%), Gaps = 2/116 (1%)
 Frame = -1

Query: 799 DQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDL 620
           D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   ++  + W  
Sbjct: 2   DNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANLQG-NDWKK 60

Query: 619 YLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRALNHR 458
            L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   L  R
Sbjct: 61  ALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHKLRDR 116


>SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 945

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 28/95 (29%), Positives = 48/95 (50%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P+++ TD G  F S   +   R  G+K +  +P  PQ  G +ER++ ++ + L+    
Sbjct: 764  GYPEVLRTDNGPQFISGEFQTFLRAGGVKWLSTTPLWPQANGLVERTNRSILKVLK-IAT 822

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            + +       R  + AY S  H+ TG +P  L+FG
Sbjct: 823  QEKADMQREFRKFVAAYRSTPHTGTGCTPFSLMFG 857


>SB_52339| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 172

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/116 (29%), Positives = 54/116 (46%), Gaps = 2/116 (1%)
 Frame = -1

Query: 799 DQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDL 620
           D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   ++  + W  
Sbjct: 2   DNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANLQG-NDWKK 60

Query: 619 YLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRALNHR 458
            L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   L  R
Sbjct: 61  ALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHKLRDR 116


>SB_12601| Best HMM Match : rve (HMM E-Value=5e-29)
          Length = 568

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 30/89 (33%), Positives = 45/89 (50%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P II++D    F  E         GIKHI ++P HP + G  ER   T KE ++    
Sbjct: 480 GLPDIIVSDNATAFIGEEFALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGG 539

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSP 557
           E ++  D  L   +L+Y +  H+ TG +P
Sbjct: 540 EKENL-DTKLSRFLLSYRTTPHANTGKTP 567


>SB_9047| Best HMM Match : RVT_1 (HMM E-Value=3.4e-19)
          Length = 1116

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/116 (29%), Positives = 54/116 (46%), Gaps = 2/116 (1%)
 Frame = -1

Query: 799  DQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDL 620
            D G  F+S+  +      GI+H    PY PQ+ G +ER + T+ + +R   ++  + W  
Sbjct: 855  DNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKVIRIANLQG-NDWKK 913

Query: 619  YLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRALNHR 458
             L   +  Y +  H+ TG SP ELL G   +  +P      D  T S++   L  R
Sbjct: 914  ALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKIPKDRATESEWQHKLRDR 969


>SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33)
          Length = 735

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 28/95 (29%), Positives = 48/95 (50%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+++ TD G  F S   +   R  G+K +  +P  PQ  G +ER++ ++ + L+    
Sbjct: 485 GYPEVLRTDNGPQFISGEFQTFLRAGGVKWLSTTPLWPQANGLVERTNRSILKVLK-IAT 543

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           + +       R  + AY S  H+ TG +P  L+FG
Sbjct: 544 QEKADMQREFRKFVAAYRSTPHTGTGCTPFSLMFG 578


>SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3038

 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 39/131 (29%), Positives = 60/131 (45%), Gaps = 5/131 (3%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  +++D G  + S+      +  G  HI +SP++PQ  G +ER+  T K  LR    
Sbjct: 2795 GIPDTVVSDNGPQYVSQEFTNFAKDMGFTHITSSPHYPQANGEVERAVQTAKNILRKN-- 2852

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK-----PYIPKSIDSLDLNTYSDY 479
             N H   L  R+A LA         G +P E+L G K     P +P+++    ++     
Sbjct: 2853 TNPHLGLLAYRSAPLA--------NGLTPSEILMGRKLRNKLPSVPENLKPRKIDQEQLL 2904

Query: 478  IRALNHRLYYS 446
             R   +R  YS
Sbjct: 2905 KREQEYRERYS 2915


>SB_46816| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1165

 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 39/131 (29%), Positives = 60/131 (45%), Gaps = 5/131 (3%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  +++D G  + S+      +  G  HI +SP++PQ  G +ER+  T K  LR    
Sbjct: 922  GIPDTVVSDNGPQYVSQEFTNFAKDMGFTHITSSPHYPQANGEVERAVQTAKNILRKN-- 979

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK-----PYIPKSIDSLDLNTYSDY 479
             N H   L  R+A LA         G +P E+L G K     P +P+++    ++     
Sbjct: 980  TNPHLGLLAYRSAPLA--------NGLTPSEILMGRKLRNKLPSVPENLKPRKIDQEQLL 1031

Query: 478  IRALNHRLYYS 446
             R   +R  YS
Sbjct: 1032 KREQEYRERYS 1042


>SB_31771| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1963

 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 39/131 (29%), Positives = 60/131 (45%), Gaps = 5/131 (3%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  +++D G  + S+      +  G  HI +SP++PQ  G +ER+  T K  LR    
Sbjct: 1720 GIPDTVVSDNGPQYVSQEFANFAKDMGFTHITSSPHYPQANGEVERAVQTAKNILRKN-- 1777

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK-----PYIPKSIDSLDLNTYSDY 479
             N H   L  R+A LA         G +P E+L G K     P +P+++    ++     
Sbjct: 1778 TNPHLGLLAYRSAPLA--------NGLTPSEILMGRKLRNKLPSVPENLKPRKIDQEQLL 1829

Query: 478  IRALNHRLYYS 446
             R   +R  YS
Sbjct: 1830 KREQEYRERYS 1840


>SB_49535| Best HMM Match : RVT_1 (HMM E-Value=5.1e-32)
          Length = 991

 Score = 52.0 bits (119), Expect = 6e-07
 Identities = 34/97 (35%), Positives = 47/97 (48%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  +I+D G  + S+      +  G  HI +SP++PQ  G +ER+  T K  LR    
Sbjct: 878  GIPDTVISDNGPQYVSQEFTNFAKDMGFTHITSSPHYPQANGEVERAVQTAKNILRKN-- 935

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
             N H   L  R+A LA         G +P E+L G K
Sbjct: 936  TNPHLGLLAYRSAPLA--------NGLTPSEILMGRK 964


>SB_47875| Best HMM Match : rve (HMM E-Value=3.3e-16)
          Length = 488

 Score = 52.0 bits (119), Expect = 6e-07
 Identities = 32/101 (31%), Positives = 45/101 (44%), Gaps = 4/101 (3%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK +ITD G  F + +++      GI+     P  P T G ++RS+ T KE LR+ + 
Sbjct: 309 GYPKKLITDNGLEFKNRLVEAFAEKNGIQISHGLPRMPTTQGLVKRSNRTFKEDLRAILQ 368

Query: 643 ENQH----TWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
              H     W      A    N   H     +P E +FGFK
Sbjct: 369 SEAHKEMKRWCESTSQASYTMNITHHRAINETPYEAVFGFK 409


>SB_31380| Best HMM Match : zf-CCHC (HMM E-Value=4.6e-05)
          Length = 1082

 Score = 51.6 bits (118), Expect = 8e-07
 Identities = 26/69 (37%), Positives = 38/69 (55%), Gaps = 2/69 (2%)
 Frame = -1

Query: 745  GIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDL--YLRTAMLAYNSNIHST 572
            GIKH    PYHPQ+  A ERS + +KE L   +++      +   L + +  Y +  HST
Sbjct: 842  GIKHTLVPPYHPQSNEAAERSVTVVKEALLKQVIQGTKGMSMKNRLDSFLFRYRTTPHST 901

Query: 571  TGFSPLELL 545
            +G SP EL+
Sbjct: 902  SGMSPAELM 910


>SB_19382| Best HMM Match : rve (HMM E-Value=8.4e-26)
          Length = 684

 Score = 51.6 bits (118), Expect = 8e-07
 Identities = 34/95 (35%), Positives = 49/95 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GI + ++ D G  +SS V  +  R +G  HI +SP +PQ  G  ER+  T+K  L+    
Sbjct: 444 GITECLVCDNGPQYSSHVFAEFAREYGFTHITSSPRYPQGNGHAERAVQTVKSLLK---- 499

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             +   D YL  ++L Y +      GFSP ELL G
Sbjct: 500 --KCNGDPYL--SLLTYRAT-PLEHGFSPSELLMG 529


>SB_19374| Best HMM Match : Phage_integrase (HMM E-Value=4.3)
          Length = 275

 Score = 51.6 bits (118), Expect = 8e-07
 Identities = 26/77 (33%), Positives = 43/77 (55%)
 Frame = -1

Query: 769 MKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYN 590
           M+Q      + H   +P  P+  G +ER + +L++ +R+   E ++ W   L   +LAY+
Sbjct: 1   MEQYFTEIEVNHTLTTPLWPRANGEVERQNCSLRKAMRAAHAEKRN-WRTELNKYLLAYS 59

Query: 589 SNIHSTTGFSPLELLFG 539
           S  H TTG SP +LL+G
Sbjct: 60  SKTHMTTGKSPAKLLYG 76


>SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39)
          Length = 1311

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 28/98 (28%), Positives = 46/98 (46%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ +++D G    S       +  GI+H     YHP + G  ER   TLK+ L +   
Sbjct: 906  GLPEEMVSDNGPPIISSEQDMFMKSNGIRHTRVPRYHPASNGEAERYVQTLKQALLTSKF 965

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            +   +    L + + +Y +  H+ TG +P EL    KP
Sbjct: 966  DQGKSLQQRLSSFLFSYRNTPHTVTGQTPAELFLKRKP 1003


>SB_4361| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 790

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 39/131 (29%), Positives = 60/131 (45%), Gaps = 5/131 (3%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  +++D G  + S+      +  G  HI +SP++PQ  G +ER+  T K  LR    
Sbjct: 539 GIPDTVVSDNGPQYVSQEFTNFAKDMGFTHITSSPHYPQANGEVERAVQTAKNILRKN-- 596

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK-----PYIPKSIDSLDLNTYSDY 479
            N H   L  R+A LA         G +P E+L G K     P +P+++    ++     
Sbjct: 597 TNPHLGLLAYRSAPLA--------NGQTPSEILMGRKLRNKLPSVPENLKPRKIDQEQLL 648

Query: 478 IRALNHRLYYS 446
            R   +R  YS
Sbjct: 649 KREQEYRERYS 659


>SB_49679| Best HMM Match : rve (HMM E-Value=8.4e-27)
          Length = 212

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 28/98 (28%), Positives = 46/98 (46%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+ +++D G    S       +  GI+H     YHP + G  ER   TLK+ L +   
Sbjct: 81  GLPEEMVSDNGPPIISSEQDMFMKSNGIRHTRVPRYHPASNGEAERYVQTLKQALLTSKF 140

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
           +   +    L + + +Y +  H+ TG +P EL    KP
Sbjct: 141 DQGKSLQQRLSSFLFSYRNTPHTVTGQTPAELFLKRKP 178


>SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39)
          Length = 1750

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 28/98 (28%), Positives = 46/98 (46%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+ +++D G    S       +  GI+H     YHP + G  ER   TLK+ L +   
Sbjct: 1029 GLPEEMVSDNGPPIISSEQDMFMKSNGIRHTRVPRYHPASNGEAERYVQTLKQALLTSKF 1088

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            +   +    L + + +Y +  H+ TG +P EL    KP
Sbjct: 1089 DQGKSLQQRLSSFLFSYRNTPHTVTGQTPAELFLKRKP 1126


>SB_24579| Best HMM Match : rve (HMM E-Value=0.085)
          Length = 318

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 39/132 (29%), Positives = 59/132 (44%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  +++D G  + S+      +  G  HI +SP++PQ  G +ER+  T K  LR    
Sbjct: 9   GIPDTVVSDNGPQYVSQEFTNFAKDMGFAHITSSPHYPQANGEVERAVQTAKNILRK--S 66

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSDYIRALN 464
            N H   L  R+A LA         G +P+ +  G +   P+ ID   L       R   
Sbjct: 67  TNPHLGLLAYRSAPLA--------NGLTPIAI--GPENLRPRKIDQEQLLKREQEYRERY 116

Query: 463 HRLYYSRQKALQ 428
              Y SR +A++
Sbjct: 117 SSNYNSRHRAVE 128


>SB_48661| Best HMM Match : rve (HMM E-Value=5.7e-17)
          Length = 745

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 33/93 (35%), Positives = 52/93 (55%), Gaps = 1/93 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP I++TD G  F+S    +    +G  HI +SP + Q+ G  ER+  T+K +L+    
Sbjct: 540 GIPDILVTDNGPQFASAEFNKFAATWGFDHITSSPRYAQSNGESERAVETIKNFLKK--- 596

Query: 643 ENQHTWDLYLRTAMLAY-NSNIHSTTGFSPLEL 548
                 D YL  A+L+Y N+ +H+  G+SP +L
Sbjct: 597 ----CDDEYL--ALLSYRNTPLHN--GYSPSQL 621


>SB_2089| Best HMM Match : rve (HMM E-Value=4.3e-20)
          Length = 240

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 34/98 (34%), Positives = 53/98 (54%), Gaps = 1/98 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP I++TD G  F+S    +    +G  HI +SP + Q+ G  ER+  T+K +L+    
Sbjct: 63  GIPDILVTDNGPQFASAEFNKFAATWGFDHITSSPRYAQSNGESERAVKTIKNFLKK--- 119

Query: 643 ENQHTWDLYLRTAMLAY-NSNIHSTTGFSPLELLFGFK 533
                 D YL  A+L+Y N+ +H+  G+ P +L  G K
Sbjct: 120 ----CDDEYL--ALLSYRNTPLHN--GYFPSQLSMGRK 149


>SB_38188| Best HMM Match : rve (HMM E-Value=5.7e-31)
          Length = 836

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 39/144 (27%), Positives = 63/144 (43%), Gaps = 10/144 (6%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P I+ +D G  F  +V+K L   F +  +   P+HPQ+ G +E  +  +K YL  ++ 
Sbjct: 236 GPPAILQSDNGGEFVGDVVKVLASHFNVHLVHGRPHHPQSQGQVENLNKQVKRYLARFLQ 295

Query: 643 -----ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP--YIPKSIDSL---DLN 494
                E    W L L       N + HST   +P  +    +P   +P+  + L   D  
Sbjct: 296 PLPRDEQGAVWPLLLSGVADLLNKSWHSTINDTPFRVYKNREPSHLVPEDSEWLAGADEE 355

Query: 493 TYSDYIRALNHRLYYSRQKALQNI 422
              DY+   N    +S  +A QN+
Sbjct: 356 CSDDYVFNEND---FSELEASQNM 376


>SB_32999| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 314

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 31/95 (32%), Positives = 44/95 (46%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P  +  + GA F S   +      GI H    P  PQ  G +ER + T  + ++   V
Sbjct: 64  GNPYTVKAEGGAQFISAEFENFFNKNGIVHRKTQPLWPQANGEVERQNRTFLKTIKVAAV 123

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           E +  W   L   +LAY S    +TG SP +L+FG
Sbjct: 124 EGKR-WQEKLAKFLLAYRSTPQVSTGASPAKLMFG 157


>SB_1340| Best HMM Match : rve (HMM E-Value=3.1e-14)
          Length = 825

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 32/95 (33%), Positives = 48/95 (50%)
 Frame = -1

Query: 817 PKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVEN 638
           P I+ +D+      E +       GIKHI ++P HP + G  ER   T KE ++    E 
Sbjct: 602 PDIMDSDKATPSLGEELALFMSENGIKHITSAPKHPASNGFAERYVRTFKETMKKMGGEK 661

Query: 637 QHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           ++  D  L   +L+Y +  H+TTG +P ELL   K
Sbjct: 662 ENL-DTKLSRFLLSYRTTPHATTGKTPGELLMNRK 695


>SB_51002| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1888

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP+ +IT     ++S +     + +G +H   SPYH Q  G +ER+  T+K  L+    
Sbjct: 1656 GIPEKLITGHDTQYTSSIFGDFSKTYGFEHTSTSPYHSQANGFIERNVQTVKNVLQKCKE 1715

Query: 643  ENQ--HTWDLYLRTAMLAYN 590
             N   H   L LRT  + +N
Sbjct: 1716 SNSDPHLAMLCLRTTPIDHN 1735


>SB_3768| Best HMM Match : Involucrin (HMM E-Value=0.021)
          Length = 205

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 3/97 (3%)
 Frame = -1

Query: 808 IITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHT 629
           I+ D G  FS+ ++        IK    S   P T G +ERS+ T KE +R+ ++  Q +
Sbjct: 2   IVCDNGTEFSNAMLNSFCEENNIKICHGSARTPTTQGLVERSNRTWKEDMRAILISKQKS 61

Query: 628 WDLYLRTAMLA-YNSNI--HSTTGFSPLELLFGFKPY 527
              + +  M A Y  NI  H     SP E +FGFK +
Sbjct: 62  VGEWCKATMEASYTMNITYHRAIKCSPYEAVFGFKAH 98


>SB_44798| Best HMM Match : rve (HMM E-Value=3.4e-33)
          Length = 243

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 27/95 (28%), Positives = 48/95 (50%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  +++D G  F+SEV  +  +  G+K    +PYHP++ G  ER   T K    +Y  
Sbjct: 101 GLPIHVVSDNGPQFTSEVFDKFMKQNGVKDTTTAPYHPKSNGQAERFVQTFK---LAYEA 157

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
                W + +   +L   +  ++TT  +P +L+ G
Sbjct: 158 GQGPPWQI-IADFLLKQRNTSNATTQHTPAKLMLG 191


>SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36)
          Length = 1198

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 34/98 (34%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP I++TD G  F+S    +    +G  HI  SP + Q+ G  E +  T+K +L+    
Sbjct: 892  GIPDILVTDSGPQFASAEFNKFAATWGFDHITPSPRYAQSNGESEGAVETIKNFLKK--- 948

Query: 643  ENQHTWDLYLRTAMLAY-NSNIHSTTGFSPLELLFGFK 533
                  D YL  A+L+Y N+ +H+  G+SP +L  G K
Sbjct: 949  ----CDDEYL--ALLSYRNTPLHN--GYSPSQLSMGRK 978


>SB_56534| Best HMM Match : RVT_1 (HMM E-Value=5.5e-28)
          Length = 1052

 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 27/76 (35%), Positives = 39/76 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  +++D G  + S+      +  G  HI +SP++PQ  G +ER+  T K  LR    
Sbjct: 973  GIPDTVVSDNGPQYVSQEFTNFAKDMGFTHITSSPHYPQANGEVERAVQTAKNILRKN-- 1030

Query: 643  ENQHTWDLYLRTAMLA 596
             N H   L  R+A LA
Sbjct: 1031 TNPHLGLLAYRSAPLA 1046


>SB_12161| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 236

 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 28/71 (39%), Positives = 40/71 (56%)
 Frame = -1

Query: 745 GIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTG 566
           GIKHI ++P HP + G  ER   T KE ++    E ++  D  L   +L+Y +  H+TTG
Sbjct: 12  GIKHITSAPKHPASNGFAERYVRTFKETMKKMGGEKENL-DTKLSRFLLSYRTTPHATTG 70

Query: 565 FSPLELLFGFK 533
            +P ELL   K
Sbjct: 71  KTPGELLMNRK 81


>SB_3041| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 939

 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 38/131 (29%), Positives = 59/131 (45%), Gaps = 5/131 (3%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  +++  G  + S+      +  G  HI +SP++PQ  G +ER+  T K  LR    
Sbjct: 696  GIPDTVVSHNGPQYVSQEFTNFAKDMGFTHITSSPHYPQAHGEVERAVQTAKNILRKN-- 753

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK-----PYIPKSIDSLDLNTYSDY 479
             N H   L  R+A LA         G +P E+L G K     P +P+++    ++     
Sbjct: 754  TNPHLGLLAYRSAPLA--------NGLTPSEILMGRKLRNKLPSVPENLRPRKIDQEQLL 805

Query: 478  IRALNHRLYYS 446
             R   +R  YS
Sbjct: 806  KREQEYRERYS 816


>SB_33828| Best HMM Match : rve (HMM E-Value=3.9e-20)
          Length = 298

 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 39/131 (29%), Positives = 59/131 (45%), Gaps = 5/131 (3%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  + +D G  + S+   +  +  G  HI +SP+ PQ  G +ER+  T K  LR    
Sbjct: 61  GIPDTVFSDNGPQYVSQEFTKFAKDMGFTHITSSPHCPQANGEVERAVQTAKNILRKN-- 118

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK-----PYIPKSIDSLDLNTYSDY 479
            N H   L  R+A LA         G +P E+L G K     P +P+++    ++     
Sbjct: 119 TNPHLGLLAYRSAPLA--------NGLTPSEILMGRKLRNKLPSVPENLRPRKIDQEQLL 170

Query: 478 IRALNHRLYYS 446
            R   +R  YS
Sbjct: 171 KREQEYRERYS 181


>SB_20630| Best HMM Match : rve (HMM E-Value=2.3e-19)
          Length = 698

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 38/134 (28%), Positives = 57/134 (42%), Gaps = 2/134 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  +++D G+ + S+      +  G  HI +SP++PQ  G +ER+  T K  LR    
Sbjct: 380 GIPDTVVSDNGSQYVSQEFTNFAKDMGFTHITSSPHYPQANGEVERAVQTAKNILRKN-- 437

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPL--ELLFGFKPYIPKSIDSLDLNTYSDYIRA 470
            N H   L  R+A      N +       L  +L   F+   P+ ID   L       R 
Sbjct: 438 TNPHLGLLAYRSAPPGKRPNPYEILMGRKLRNKLPSVFENLRPRKIDQEQLLKREQEYRE 497

Query: 469 LNHRLYYSRQKALQ 428
                Y SR +A +
Sbjct: 498 RYSSNYNSRHRAAE 511


>SB_57797| Best HMM Match : rve (HMM E-Value=6.9e-21)
          Length = 368

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSS--------EVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +I+D G  +S+           KQ    +G +H+ +SP +PQ+ GA ER+  T K
Sbjct: 106 GIPAKVISDNGPQYSNTRNIFSTTHEFKQFAEAWGFQHVTSSPEYPQSNGAAERAVQTAK 165

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
              +    EN+  ++      +L Y +      G SP +LL
Sbjct: 166 RIFKKAAAENKDPFE-----GLLKYRNTPFDDIGVSPAQLL 201


>SB_55060| Best HMM Match : rve (HMM E-Value=0.0085)
          Length = 277

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSS--------EVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +I+D G  +S+           KQ    +G +H+ +SP +PQ+ GA ER+  T K
Sbjct: 15  GIPAKVISDNGPQYSNTRNIFSTTHEFKQFAEAWGFQHVTSSPEYPQSNGAAERAVQTAK 74

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
              +    EN+  ++      +L Y +      G SP +LL
Sbjct: 75  RIFKKAAAENKDPFE-----GLLKYRNTPFDDIGVSPAQLL 110


>SB_53148| Best HMM Match : rve (HMM E-Value=4.8e-21)
          Length = 1329

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSE--------VMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
            GIP  +I+D G  +S+           KQ    +G +H+ +SP +PQ+ GA ER+  T K
Sbjct: 1067 GIPAKVISDNGPQYSNNRNIFSTTHEFKQFAEAWGFQHVTSSPEYPQSNGAAERAVQTAK 1126

Query: 667  EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
               +    EN+  ++      +L Y +      G SP +LL
Sbjct: 1127 RIFKKAAAENKDPFE-----GLLKYRNTPFDDIGVSPAQLL 1162


>SB_31616| Best HMM Match : rve (HMM E-Value=6.9e-21)
          Length = 1183

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSS--------EVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
            GIP  +I+D G  +S+           KQ    +G +H+ +SP +PQ+ GA ER+  T K
Sbjct: 921  GIPAKVISDNGPQYSNTRNIFSTTHEFKQFAEAWGFQHVTSSPEYPQSNGAAERAVQTAK 980

Query: 667  EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
               +    EN+  ++      +L Y +      G SP +LL
Sbjct: 981  RIFKKAAAENKDPFE-----GLLKYRNTPFDDIGVSPAQLL 1016


>SB_24272| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21)
          Length = 1197

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSS--------EVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
            GIP  +I+D G  +S+           KQ    +G +H+ +SP +PQ+ GA ER+  T K
Sbjct: 935  GIPAKVISDNGPQYSNTRNIFSTTHEFKQFAEAWGFQHVTSSPEYPQSNGAAERAVQTAK 994

Query: 667  EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
               +    EN+  ++      +L Y +      G SP +LL
Sbjct: 995  RIFKKAAAENKDPFE-----GLLKYRNTPFDDIGVSPAQLL 1030


>SB_17261| Best HMM Match : rve (HMM E-Value=6.9e-21)
          Length = 356

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSS--------EVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +I+D G  +S+           KQ    +G +H+ +SP +PQ+ GA ER+  T K
Sbjct: 241 GIPAKVISDNGPQYSNTRNIFSTTHEFKQFAEAWGFQHVTSSPEYPQSNGAAERAVQTAK 300

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
              +    EN+  ++      +L Y +      G SP +LL
Sbjct: 301 RIFKKAAAENKDPFE-----GLLKYRNTPFDDIGVSPAQLL 336


>SB_15802| Best HMM Match : rve (HMM E-Value=6.9e-21)
          Length = 481

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSS--------EVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +I+D G  +S+           KQ    +G +H+ +SP +PQ+ GA ER+  T K
Sbjct: 219 GIPAKVISDNGPQYSNTRNIFSTTHEFKQFAEAWGFQHVTSSPEYPQSNGAAERAVQTAK 278

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
              +    EN+  ++      +L Y +      G SP +LL
Sbjct: 279 RIFKKAAAENKDPFE-----GLLKYRNTPFDDIGVSPAQLL 314


>SB_59754| Best HMM Match : rve (HMM E-Value=8e-19)
          Length = 1065

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 36/131 (27%), Positives = 61/131 (46%), Gaps = 5/131 (3%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  +++D G  + S+      +  G  HI +S ++PQ  G ++R+  T K  LR    
Sbjct: 719  GIPDTVVSDNGPQYVSQEFTNFAKDMGFTHITSSSHYPQANGEVKRAVQTAKNILRKN-- 776

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK-----PYIPKSIDSLDLNTYSDY 479
             N+H         +LAY S+     G +P E+L G K     P +P+++    ++     
Sbjct: 777  TNRH-------LGLLAY-SSAPLANGLTPSEILMGRKLCNKLPSVPENLRPRKIDQEQLL 828

Query: 478  IRALNHRLYYS 446
             R   +R +YS
Sbjct: 829  KREQEYREHYS 839


>SB_37291| Best HMM Match : rve (HMM E-Value=4.8e-19)
          Length = 214

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 2/89 (2%)
 Frame = -1

Query: 826 IGIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           +G+P+ I+TD G    S V +   ++ GI+H+    Y+P T G  ER   + K  +   +
Sbjct: 130 MGLPEQIVTDNGPQIKSRVFEHFNKMNGIRHVTGRAYNPVTNGLAERLVQSFKTGVNVDL 189

Query: 646 VEN--QHTWDLYLRTAMLAYNSNIHSTTG 566
                QH  D +L     A+ ++ H+TTG
Sbjct: 190 TGRSLQHKLDRFL----FAFRNSPHATTG 214


>SB_23407| Best HMM Match : rve (HMM E-Value=6.9e-21)
          Length = 327

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSS--------EVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +I+D G  +S+           KQ    +G +H+ +SP +PQ+ GA ER+  T K
Sbjct: 166 GIPAKVISDNGPQYSNTRNIFSTTHEFKQFAEAWGFQHVTSSPEYPQSNGAAERAVQTAK 225

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
              +    EN+  ++      +L Y +      G SP +LL
Sbjct: 226 RIFKKAAAENKDPFE-----GLLKYRNTPFDDIGVSPAQLL 261


>SB_12115| Best HMM Match : rve (HMM E-Value=6.9e-21)
          Length = 428

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSS--------EVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +I+D G  +S+           KQ    +G +H+ +SP +PQ+ GA ER+  T K
Sbjct: 166 GIPAKVISDNGPQYSNTRNIFSTTHEFKQFAEAWGFQHVTSSPEYPQSNGAAERAVQTAK 225

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
              +    EN+  ++      +L Y +      G SP +LL
Sbjct: 226 RIFKKAAAENKDPFE-----GLLKYRNTPFDDIGVSPAQLL 261


>SB_10467| Best HMM Match : zf-PARP (HMM E-Value=5.6e-35)
          Length = 1311

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSS--------EVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
            GIP  +I+D G  +S+           KQ    +G +H+ +SP +PQ+ GA ER+  T K
Sbjct: 1049 GIPAKVISDNGPQYSNTRNIFSTTHEFKQFAEAWGFQHVTSSPEYPQSNGAAERAVQTAK 1108

Query: 667  EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
               +    EN+  ++      +L Y +      G SP +LL
Sbjct: 1109 RIFKKAAAENKDPFE-----GLLKYRNTPFDDIGVSPAQLL 1144


>SB_25312| Best HMM Match : Vicilin_N (HMM E-Value=0.61)
          Length = 219

 Score = 48.0 bits (109), Expect = 9e-06
 Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 3/97 (3%)
 Frame = -1

Query: 808 IITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHT 629
           I  D G  FS+ +         I+    SP  P T G +ERS+ T KE +R+ ++  Q +
Sbjct: 2   IFCDNGTEFSNAMPDSFCEENNIEICHESPRTPTTQGLVERSNRTWKEDMRAILISKQKS 61

Query: 628 WDLYLRTAMLA-YNSNI--HSTTGFSPLELLFGFKPY 527
              + +  M A Y  NI  H     SP E +FGFK +
Sbjct: 62  VGEWCKATMEASYTMNITYHRAIKCSPYEAVFGFKAH 98


>SB_50857| Best HMM Match : RVT_1 (HMM E-Value=9.8e-33)
          Length = 829

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 25/73 (34%), Positives = 38/73 (52%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  +++D G+ + S+      +  G  HI +SP++PQ  G +ER+  T K  LR    
Sbjct: 751 GIPDTVVSDNGSQYVSQEFTNFAKDMGFTHITSSPHYPQANGEVERAVQTAKNILRKN-- 808

Query: 643 ENQHTWDLYLRTA 605
            N H   L  R+A
Sbjct: 809 TNPHLGLLAYRSA 821


>SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1702

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 27/80 (33%), Positives = 41/80 (51%)
 Frame = -1

Query: 778  SEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAML 599
            SE  +   +  GI+HI ++PYHP T G  ER   T K+ +  +  + +      +   +L
Sbjct: 1269 SEEFEYFLKRNGIRHITSAPYHPSTNGLTERFVQTFKKGISGF--KEKVPLQTKVDIVLL 1326

Query: 598  AYNSNIHSTTGFSPLELLFG 539
            AY +  H TTG  P+ LL G
Sbjct: 1327 AYRNAPHGTTGQPPVVLLMG 1346


>SB_25583| Best HMM Match : rve (HMM E-Value=5.9e-05)
          Length = 163

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 26/95 (27%), Positives = 47/95 (49%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  +++D G+ F+SE   +  +  G+KH   +PYHP++ G  ER   T K    +   
Sbjct: 21  GLPIHVVSDNGSQFTSEAFDKFMKQNGVKHTTTAPYHPKSNGQAERFVQTFKLAYEA--- 77

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             Q      +   +L   +  ++TT  +P +L+ G
Sbjct: 78  -GQGPPSQIIADFLLKQRNTSNATTQQTPAKLMLG 111


>SB_23305| Best HMM Match : RVT_1 (HMM E-Value=0.0013)
          Length = 808

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 20/42 (47%), Positives = 27/42 (64%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCG 698
           G P  I+ DQG  F +++ KQLE L G++H   +PYHPQ  G
Sbjct: 586 GSPARILHDQGKEFENDLFKQLESLSGVRHARTTPYHPQGNG 627


>SB_10363| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 975

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 38/137 (27%), Positives = 59/137 (43%), Gaps = 15/137 (10%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTL--------- 671
            GIP  + +D G  F+S+  +      GI+H    PY PQ+ G +ER + T+         
Sbjct: 630  GIPYTVRSDNGPPFASKEFENFLEFLGIEHKKGIPYWPQSNGEVERCNRTILKSNGEVER 689

Query: 670  --KEYLRSYIVEN--QHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG--FKPYIPKSID 509
              +  L+   + N   + W   L   +  Y +  H+ TG SP ELL G   +  +P    
Sbjct: 690  CNRTILKVIRIANLQGNDWKKALDDFLFQYRTTNHAATGCSPAELLMGRQLRDKLPSVKI 749

Query: 508  SLDLNTYSDYIRALNHR 458
              D  T S++   L  R
Sbjct: 750  PKDRATESEWQHKLRDR 766


>SB_41747| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 605

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 29/101 (28%), Positives = 48/101 (47%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSS--------EVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +I+D G  +S+           KQ    +G +H+ +SP +PQ+ G+ ER+  T K
Sbjct: 375 GIPAKVISDNGPQYSNTRNIFSTTHEFKQFAEAWGFQHVTSSPEYPQSNGSAERAVQTAK 434

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
              +    EN+  ++      +L Y +      G SP +LL
Sbjct: 435 RIFKKAAAENKDPFE-----GLLKYRNTPFDDIGVSPAQLL 470


>SB_9257| Best HMM Match : RVT_1 (HMM E-Value=9.1e-32)
          Length = 1086

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 19/52 (36%), Positives = 31/52 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
            G+P  +++D G+ F+SE   +  +  G+KH   +PYHP++ G  ER   T K
Sbjct: 900  GLPIHVVSDNGSQFTSEAFDKFMKQNGVKHTTTAPYHPKSNGQAERFVQTFK 951


>SB_44206| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 770

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 29/101 (28%), Positives = 48/101 (47%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSS--------EVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +I+D G  +S+           KQ    +G +H+ +SP +PQ+ GA +R+  T K
Sbjct: 508 GIPAKVISDNGPQYSNTRNIFSTTHEFKQFAEAWGFQHVTSSPEYPQSNGAAKRAVQTAK 567

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
              +    EN+  ++      +L Y +      G SP +LL
Sbjct: 568 RIFKKAAAENKDPFE-----GLLKYRNTPFDDIGVSPAQLL 603


>SB_25794| Best HMM Match : rve (HMM E-Value=6.6e-17)
          Length = 267

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 32/95 (33%), Positives = 45/95 (47%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  ++TD G  F+SE  KQ   ++G     +SP H Q  GA E    T K  L+    
Sbjct: 77  GIPDTVVTDNGPQFASENFKQFAIVWGYDVHPSSPGHQQANGAAESVVKTAKRLLKKAKA 136

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             +   D YL  A+LA+ +      G SP + + G
Sbjct: 137 SGK---DPYL--ALLAHRNTPLEAIGSSPAQKMLG 166


>SB_20716| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 423

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 26/95 (27%), Positives = 46/95 (48%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  +++D G  F+SE   +  +  G+KH   +PYHP++ G  ER   T K    +   
Sbjct: 163 GLPIHVVSDNGPQFTSEAFAKFMKQNGVKHTTTAPYHPKSNGQAERFVQTFKLAYEA--- 219

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             Q      +   +L   +  ++TT  +P +L+ G
Sbjct: 220 -GQGPPSQIIADFLLKQRNTSNATTQQTPAKLMLG 253


>SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2309

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 26/95 (27%), Positives = 46/95 (48%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +++D G  F+SE   +  +  G+KH   +PYHP++ G  ER   T K    +   
Sbjct: 927  GLPIHVVSDNGPQFTSEAFDKFMKQNGVKHTTTAPYHPKSNGQAERFVQTFKLAYEA--- 983

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
              Q      +   +L   +  ++TT  +P +L+ G
Sbjct: 984  -GQGPPSQIIADFLLKQRNTSNTTTQQTPAKLMLG 1017


>SB_49747| Best HMM Match : RVT_1 (HMM E-Value=2.1e-36)
          Length = 877

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 26/95 (27%), Positives = 46/95 (48%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  +++D G  F+SE   +  +  G+KH   +PYHP++ G  ER   T K    +   
Sbjct: 710 GLPIHVVSDNGPQFTSEAFDKFMKQNGVKHTTTAPYHPKSNGQAERFVQTFKLAYEA--- 766

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             Q      +   +L   +  ++TT  +P +L+ G
Sbjct: 767 -GQGPPSQIIADFLLKQRNTSNTTTQQTPAKLMLG 800


>SB_47161| Best HMM Match : rve (HMM E-Value=1.8e-22)
          Length = 1046

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 25/95 (26%), Positives = 48/95 (50%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+++ +D G  F+ +         G KH   +P   +  G +ER   T+K+ +++   
Sbjct: 810  GVPEVVRSDNGPPFNGKEFASFADDLGFKHRKVTPKWARANGEVERFVRTVKKVIKTAKT 869

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            EN+ ++   ++  +  Y +  HSTT  +P   LFG
Sbjct: 870  ENK-SYKQEMQRLLRNYRATPHSTTRVAPATALFG 903


>SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25)
          Length = 1641

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 25/95 (26%), Positives = 49/95 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+++ +D G+ F+ +         G KH   +P   +  G +ER   T+K+ +++   
Sbjct: 1463 GVPEVVRSDNGSPFNRKEFASFADDLGFKHRKVTPKWARANGEVERFVRTVKKVIKTAKT 1522

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            EN+ ++   ++  +  Y +  HSTT  +P   LFG
Sbjct: 1523 ENK-SYKQEMQWLLRNYRATPHSTTRVAPATALFG 1556


>SB_45729| Best HMM Match : rve (HMM E-Value=5.8e-21)
          Length = 611

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 25/95 (26%), Positives = 49/95 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+++ +D G+ F+ +         G KH   +P   +  G +ER   T+K+ +++   
Sbjct: 380 GVPEVVRSDNGSPFNRKEFASFADDLGFKHRKVTPKWARANGEVERFVRTVKKVIKTAKT 439

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           EN+ ++   ++  +  Y +  HSTT  +P   LFG
Sbjct: 440 ENK-SYKQEMQWLLRNYRATPHSTTRVAPATALFG 473


>SB_15544| Best HMM Match : rve (HMM E-Value=9.6e-05)
          Length = 119

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 23/64 (35%), Positives = 34/64 (53%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK ++TD G  F + +++      GI+    SP  P T G +ERS+ T KE LR+ + 
Sbjct: 22  GYPKKLVTDNGLEFKNRLVEAFAEKNGIQISHGSPRMPTTQGLVERSNRTFKEDLRAILQ 81

Query: 643 ENQH 632
              H
Sbjct: 82  SEAH 85


>SB_25619| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1038

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 26/89 (29%), Positives = 47/89 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P+ + +D G   +S   +   R  GIK +  +P  PQ  G +ER++ ++++ L+   V
Sbjct: 924  GYPEALRSDYGPQLTSVDFEAYLRSNGIKWVSTTPLWPQANGLVERTNRSIEKILKIATV 983

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSP 557
            E +     + R  ++AY S  H +TG +P
Sbjct: 984  EKKDLQKEF-RKFLVAYRSTPHKSTGCTP 1011


>SB_12331| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 748

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK I+ D G  F + ++        I+    SP  P T G +ERS+ T KE +R+ ++
Sbjct: 507 GFPKKIVCDNGTEFWNAMLNSFCEENNIEICHGSPRTPTTQGLVERSNRTWKEDMRAILI 566

Query: 643 ENQHTWDLYLRTAMLA-YNSNI 581
             Q +   + +  M A YN NI
Sbjct: 567 SKQKSVGEWFKATMEASYNMNI 588


>SB_45481| Best HMM Match : rve (HMM E-Value=3.1e-17)
          Length = 414

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 28/93 (30%), Positives = 46/93 (49%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  +I+D G  ++      +   +G +HI +SP +PQ+ GA ER+  T K   +    
Sbjct: 166 GIPAKVISDNGPQYT------VSEAWGFQHITSSPEYPQSNGAAERAVQTAKRIFKKAAA 219

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
           EN+  ++      +L Y +      G SP +LL
Sbjct: 220 ENKDPFE-----GLLKYRNTPFDDIGVSPAQLL 247


>SB_33158| Best HMM Match : rve (HMM E-Value=7.5e-05)
          Length = 848

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 41/134 (30%), Positives = 67/134 (50%), Gaps = 2/134 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  I +D G  F++   +   RL+GIKH  +S   PQ+ G  E +  T K  L S   
Sbjct: 508 GVPTEISSDGGPEFTAGGTETFLRLWGIKHRLSSVGFPQSNGRAEVAVKTAKRLLMSNTG 567

Query: 643 EN-QHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD-YIRA 470
            N     D +LR AML   +        SP +++FG +P +  S+    L  +S+ +IR 
Sbjct: 568 PNGSLDNDRFLR-AMLQLRNTPDRDCDLSPAQIIFG-RP-LRDSLMLYRLEKFSNPHIRP 624

Query: 469 LNHRLYYSRQKALQ 428
           L  + + +++ AL+
Sbjct: 625 LWRQAWAAKEDALR 638


>SB_1797| Best HMM Match : rve (HMM E-Value=8.5e-35)
          Length = 285

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 19/52 (36%), Positives = 30/52 (57%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           G+P  +++D G  F+SE   +  +  G+KH   +PYHP++ G  ER   T K
Sbjct: 159 GLPIHVVSDNGPQFTSEAFDKFMKQNGVKHTTTAPYHPKSNGQAERFVQTFK 210


>SB_58301| Best HMM Match : DUF1168 (HMM E-Value=7.6)
          Length = 253

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 2/98 (2%)
 Frame = -1

Query: 745 GIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTG 566
           GI+H    PY PQ+ G +ER + T+ + +R   ++  + W   L   +  Y +  H+ TG
Sbjct: 10  GIEHKKGIPYWPQSNGEVERCNRTILKVIRIANLQG-NDWKKALDDFLFQYRTTNHAATG 68

Query: 565 FSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRALNHR 458
            SP ELL G   +  +P      D  T S++   L  R
Sbjct: 69  CSPAELLMGRQLRDKLPSVKIPKDRATESEWQHKLRDR 106


>SB_53641| Best HMM Match : rve (HMM E-Value=7.9e-14)
          Length = 691

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 20/67 (29%), Positives = 36/67 (53%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L+ + +
Sbjct: 481 GIPDKLVTGHDTQFTSALFKVFSSTYGFIHTTTSPYYKEANGFIERNVQTVKDLLQKHAL 540

Query: 643 ENQHTWD 623
            N+  +D
Sbjct: 541 LNKPDYD 547


>SB_53108| Best HMM Match : DUF1168 (HMM E-Value=7.1)
          Length = 253

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 2/98 (2%)
 Frame = -1

Query: 745 GIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTG 566
           GI+H    PY PQ+ G +ER + T+ + +R   ++  + W   L   +  Y +  H+ TG
Sbjct: 10  GIEHKKGIPYWPQSNGEVERCNRTILKVIRIANLQG-NDWKKALDDFLFQYRTTNHAATG 68

Query: 565 FSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRALNHR 458
            SP ELL G   +  +P      D  T S++   L  R
Sbjct: 69  CSPAELLMGRQLRDKLPSVKIPKDRATKSEWQHKLRDR 106


>SB_49427| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1958

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 22/72 (30%), Positives = 36/72 (50%)
 Frame = -1

Query: 691  ERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
            +R    L E L  Y+   Q  WD+++ + + A+ ++I  +TG SP  LL+G  P +P  +
Sbjct: 1736 DRGKHFLSESLSMYLDVKQKDWDIFIPSVLFAHRTSISDSTGDSPFYLLYGRSPSLPIDV 1795

Query: 511  DSLDLNTYSDYI 476
              L     S  I
Sbjct: 1796 SLLPCKEVSTSI 1807


>SB_2953| Best HMM Match : DUF1168 (HMM E-Value=7.6)
          Length = 253

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 30/98 (30%), Positives = 47/98 (47%), Gaps = 2/98 (2%)
 Frame = -1

Query: 745 GIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTG 566
           GI+H    PY PQ+ G +ER + T+ + +R   ++  + W   L   +  Y +  H+ TG
Sbjct: 10  GIEHKKGIPYWPQSNGEVERCNRTILKVIRIANLQG-NDWKKALDDFLFQYRTTNHAATG 68

Query: 565 FSPLELLFG--FKPYIPKSIDSLDLNTYSDYIRALNHR 458
            SP ELL G   +  +P      D  T S++   L  R
Sbjct: 69  CSPAELLMGRQLRDKLPSVKIPKDRATESEWQHKLRDR 106


>SB_46458| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 761

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P ++I+D G N+SS+  ++  + + I H+  SP+H ++ G +E +   +K+ +     
Sbjct: 502 GTPAVLISDNGTNYSSQEFQEFTKAWEIYHVTVSPHHHKSNGKVESAVKIMKKVIIKAKK 561

Query: 643 ENQHTWDLYLRTAMLAYNS-NIH--STTGFSP 557
           +    W   L       NS NI   STT + P
Sbjct: 562 DGSDLWKSLLEWMEKLTNSRNIQLTSTTTYVP 593


>SB_44253| Best HMM Match : rve (HMM E-Value=8.4e-10)
          Length = 589

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 28/95 (29%), Positives = 51/95 (53%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP++I +  G  +SS+  ++    +G KHI +SP +P++ G +ER      +Y++S ++
Sbjct: 444 GIPQVIRSYNGPQYSSKEFEEFAMKYGFKHITSSPTYPKSNGFIERQ----VKYVKSALI 499

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           E + +        +    + I+S    SP ELL G
Sbjct: 500 EAKRSHTDPNMALLCLLTTTINSKLP-SPAELLLG 533


>SB_23363| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 290

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 5/75 (6%)
 Frame = -1

Query: 628 WDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI----DSLDL-NTYSDYIRALN 464
           W  Y+   + AYN+  HSTTG+SP  L+FG  P +P+ +    D +     Y+ YI  L 
Sbjct: 12  WPDYVARLVHAYNATKHSTTGYSPSYLMFGRNPRLPQDVTLGPDPVHYPQPYAAYIENLR 71

Query: 463 HRLYYSRQKALQNIE 419
             L  +  +A Q IE
Sbjct: 72  DNLTDAYSRAQQEIE 86


>SB_20587| Best HMM Match : rve (HMM E-Value=7.2e-15)
          Length = 1485

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 40/134 (29%), Positives = 65/134 (48%), Gaps = 2/134 (1%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I +D G  F++   +   RL+GIKH  +S   PQ+ G  E +  T K  L S   
Sbjct: 1331 GVPTEISSDGGPEFTAGGTETFLRLWGIKHRLSSVGFPQSNGRAEVAVKTAKRLLMSNTG 1390

Query: 643  EN-QHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD-YIRA 470
             N     D +LR AML   +        SP +++FG +P     +    L  +S+ +IR 
Sbjct: 1391 PNGSLDNDRFLR-AMLQLRNTPDRDCDLSPAQIIFG-RPLRDSLMFVNRLEKFSNPHIRP 1448

Query: 469  LNHRLYYSRQKALQ 428
            L  + + +++ AL+
Sbjct: 1449 LWRQAWAAKEDALR 1462


>SB_12598| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 799

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 28/101 (27%), Positives = 50/101 (49%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFS--------SEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +++D G+ +S        S   K+    +G +H  +SP +PQ+ GA E++  T K
Sbjct: 562 GIPVEVLSDNGSQYSNTRNLFNSSHEFKKFADEWGFRHTTSSPEYPQSNGAAEKAVQTAK 621

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
            +L+    +N+  ++      +L Y +      G SP +LL
Sbjct: 622 RFLKKAAADNKDPFE-----GLLKYRNTPFDDLGVSPAQLL 657


>SB_11668| Best HMM Match : rve (HMM E-Value=6.2e-14)
          Length = 597

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 33/104 (31%), Positives = 49/104 (47%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P  ++TD+   F+SE  ++  +  GI H+  + YHP T GA ER   T ++ L    V
Sbjct: 327 GYPHTLVTDKATTFTSEEFQEWTKSRGITHLTGAQYHPATNGAAERLVQTFEKSL----V 382

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
           +        L+  +  Y     S  G+SP ELL G +   P  I
Sbjct: 383 KIDGPPKAALQQFLQQYRRTPLS-CGYSPSELLNGRQIRTPLDI 425


>SB_7962| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1269

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 40/134 (29%), Positives = 65/134 (48%), Gaps = 2/134 (1%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I +D G  F++   +   RL+GIKH  +S   PQ+ G  E +  T K  L S   
Sbjct: 928  GVPTEISSDGGPEFTAGGTETFLRLWGIKHRLSSVGFPQSNGRAEVAVKTAKRLLMSNTG 987

Query: 643  EN-QHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD-YIRA 470
             N     D +LR AML   +        SP +++FG +P     +    L  +S+ +IR 
Sbjct: 988  PNGSLDNDRFLR-AMLQLRNTPDRDCDLSPAQIIFG-RPLRDSLMFVNRLEKFSNPHIRP 1045

Query: 469  LNHRLYYSRQKALQ 428
            L  + + +++ AL+
Sbjct: 1046 LWRQAWAAKEDALR 1059


>SB_59576| Best HMM Match : rve (HMM E-Value=3.7e-14)
          Length = 707

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 40/134 (29%), Positives = 65/134 (48%), Gaps = 2/134 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  I +D G  F++   +   RL+GIKH  +S   PQ+ G  E +  T K  L S   
Sbjct: 532 GVPTEISSDGGPEFTAGGTETFLRLWGIKHRLSSVGFPQSNGRAEVAVKTAKRLLMSNTG 591

Query: 643 EN-QHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD-YIRA 470
            N     D +LR AML   +        SP +++FG +P     +    L  +S+ +IR 
Sbjct: 592 PNGSLDNDRFLR-AMLQLRNTPDRDCDLSPAQIIFG-RPLRDSLMFVNRLEKFSNPHIRP 649

Query: 469 LNHRLYYSRQKALQ 428
           L  + + +++ AL+
Sbjct: 650 LWRQAWAAKEDALR 663


>SB_23039| Best HMM Match : rve (HMM E-Value=2.8e-20)
          Length = 984

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 26/89 (29%), Positives = 46/89 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G P+ + +  G   +S   +   R  GIK +  +P  PQ  G +ER++ T+++ L+   V
Sbjct: 863  GYPEALRSHYGPQLTSVDFEAYLRSNGIKWVSTTPLWPQANGLVERTNETIEKVLKIATV 922

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSP 557
            E +     + R  ++AY S  H +TG +P
Sbjct: 923  EKKDLQKEF-RKFLVAYRSTPHKSTGCTP 950


>SB_53393| Best HMM Match : RVT_1 (HMM E-Value=5.8e-30)
          Length = 1246

 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 24/73 (32%), Positives = 37/73 (50%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  +++D G  + S+      +  G  HI +SP++PQ  G +ER+  T K  L+    
Sbjct: 1043 GIPDTVVSDNGPQYVSQEFTNFAKDMGFTHITSSPHYPQANGEVERAVQTAKNILQKN-- 1100

Query: 643  ENQHTWDLYLRTA 605
             N H   L  R+A
Sbjct: 1101 TNPHLGLLAYRSA 1113


>SB_29642| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 276

 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 3/87 (3%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L+    
Sbjct: 29  GIPNKLVTGHDTQFTSALFKVFSSTYGFIHTTTSPYYKEANGFIERNVQTVKDLLQKCKE 88

Query: 643 ENQ--HTWDLYLRTAML-AYNSNIHST 572
             Q  H   L LRT  L   NS I+ +
Sbjct: 89  SGQDPHLAMLCLRTTPLELLNSRIYQS 115


>SB_27280| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 980

 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 3/87 (3%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L+    
Sbjct: 733 GIPNKLVTGHDTQFTSALFKVFSSTYGFIHTTTSPYYKEANGFIERNVQTVKDLLQKCKE 792

Query: 643 ENQ--HTWDLYLRTAML-AYNSNIHST 572
             Q  H   L LRT  L   NS I+ +
Sbjct: 793 SGQDPHLAMLCLRTTPLELLNSRIYQS 819


>SB_3315| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 254

 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 18/52 (34%), Positives = 31/52 (59%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           G+P  ++++ G+ F+SE   +  +  G+KH   +PYHP++ G  ER   T K
Sbjct: 188 GLPIHVVSNNGSQFTSEAFDKFMKQNGVKHTTTAPYHPKSNGQAERFVQTFK 239


>SB_25412| Best HMM Match : rve (HMM E-Value=1.6e-05)
          Length = 508

 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 19/57 (33%), Positives = 31/57 (54%)
 Frame = -1

Query: 817 PKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           P I+ +D G  F  +V+K L   F +  +   PYHPQ+ G +E  +  +K YL  ++
Sbjct: 317 PDILQSDNGGEFVGDVVKVLASHFNVHLVHGRPYHPQSQGQVENLNKQVKRYLARFL 373


>SB_59388| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 350

 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 27/82 (32%), Positives = 40/82 (48%), Gaps = 1/82 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK I+ D G  FS+ ++        IK    S   P T G +ERS+ T KE +R+ ++
Sbjct: 268 GFPKKIVCDNGTEFSNAMLNSFCEENNIKICHGSARTPTTQGLVERSNRTWKEDMRAILI 327

Query: 643 ENQHTWDLYLRTAMLA-YNSNI 581
             Q +   + +  M A Y  NI
Sbjct: 328 SKQKSVGEWCKATMEASYTMNI 349


>SB_56290| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 486

 Score = 44.8 bits (101), Expect = 9e-05
 Identities = 26/83 (31%), Positives = 42/83 (50%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK ++TD G+ F S   +   +  GI H  +SPY+P+  G +ER H  L   LR+  +
Sbjct: 231 GNPKEVVTDNGSQFISGEFEDFLKSKGIAHSRSSPYYPKANGQVERFHRYLGYGLRAAEI 290

Query: 643 ENQHTWDLYLRTAMLAYNSNIHS 575
           +   +W   L   +  Y +  H+
Sbjct: 291 DG-ISWMDALPGILQVYRATPHA 312


>SB_37239| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19)
          Length = 690

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSS--------EVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +I+D G+ +S+           K + + +G +HI +SP +PQ+ GA E++  T K
Sbjct: 574 GIPDQVISDNGSQYSNTRNLFDSTHQFKVIAKEWGFQHITSSPEYPQSNGAAEKAVQTAK 633

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
             L+    + +  ++      +L Y +      G SP++LL
Sbjct: 634 RILKKADADGKDPFE-----GLLKYRNTPFEDIGVSPVQLL 669


>SB_19553| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1744

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 24/94 (25%), Positives = 47/94 (50%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P+++ +D G  F+ +         G KH   +P   +  G +ER   T+K+ +++   
Sbjct: 1505 GVPEVVRSDNGPPFNGKEFASFADDLGFKHRKVTPKWARANGEVERFVRTVKKVIKTAKT 1564

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF 542
            EN+ ++   ++  +  Y +  HSTT  +P   LF
Sbjct: 1565 ENK-SYKQEMQRLLKNYRATPHSTTRVAPATALF 1597


>SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45)
          Length = 773

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 20/63 (31%), Positives = 34/63 (53%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  I++D G  F S   +Q    +GI+H+ +SP + Q+ G +E +  T K  ++    
Sbjct: 207 GIPDQIMSDNGPPFDSHEFRQFTNSYGIQHVTSSPGYAQSNGKIENAIKTAKNLMKKATE 266

Query: 643 ENQ 635
            N+
Sbjct: 267 SNK 269


>SB_54350| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 924

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 2/79 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYL--RSY 650
           GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L  R  
Sbjct: 669 GIPDKLVTGHDTQFTSALFKGFSSTYGFIHTTTSPYYKEANGFIERNVQTVKDLLQKRKE 728

Query: 649 IVENQHTWDLYLRTAMLAY 593
             ++ H   L LRT  L +
Sbjct: 729 SGQDPHLAMLCLRTTPLGH 747


>SB_16778| Best HMM Match : rve (HMM E-Value=2.9e-22)
          Length = 419

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 24/94 (25%), Positives = 47/94 (50%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P+++ +D G  F+ +         G KH   +P   +  G +ER   T+K+ +++   
Sbjct: 304 GVPEVVRSDNGPPFNGKEFASFADDLGFKHRKVTPKWARANGEVERFVRTVKKVIKTAKT 363

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF 542
           EN+ ++   ++  +  Y +  HSTT  +P   LF
Sbjct: 364 ENK-SYKQEMQRLLKNYRATPHSTTRVAPATALF 396


>SB_10389| Best HMM Match : rve (HMM E-Value=1.8e-15)
          Length = 256

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSS--------EVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +I+D G+ +S+           K + + +G +HI +SP +PQ+ GA E++  T K
Sbjct: 140 GIPDQVISDNGSQYSNTRNLFDSTHQFKVIAKEWGFQHITSSPEYPQSNGAAEKAVQTAK 199

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
             L+    + +  ++      +L Y +      G SP++LL
Sbjct: 200 RILKKADADGKDPFE-----GLLKYRNTPFEDIGVSPVQLL 235


>SB_59067| Best HMM Match : rve (HMM E-Value=2.1e-15)
          Length = 374

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L+    
Sbjct: 242 GIPDKLVTGHDTQFTSALFKVFSSTYGFIHTTTSPYYEEANGFIERNVQTVKDLLQKCKE 301

Query: 643 ENQ--HTWDLYLRTAMLAY 593
             Q  H   L LRT  L +
Sbjct: 302 SGQDPHLAMLCLRTTPLGH 320


>SB_57305| Best HMM Match : rve (HMM E-Value=6.6e-22)
          Length = 351

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFS--------SEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +++D G+ +S        S   K+    +G +H  +SP +PQ+ GA E++  T K
Sbjct: 88  GIPVEVLSDNGSQYSNTRNLFNSSHEFKKFADEWGFRHTTSSPEYPQSNGAAEKAVQTAK 147

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
             L+    +N+  ++      +L Y +      G SP +LL
Sbjct: 148 RILKKAAADNKDPFE-----GLLKYRNTPFDDLGVSPAQLL 183


>SB_41311| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 753

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L+    
Sbjct: 474 GIPDKLVTGHDTQFTSALFKVFSSTYGFIHTTTSPYYKEANGFIERNVQTVKDLLQKCKE 533

Query: 643 ENQ--HTWDLYLRTAMLAY 593
             Q  H   L LRT  L +
Sbjct: 534 SGQDPHLAMLCLRTTPLGH 552


>SB_37892| Best HMM Match : rve (HMM E-Value=2.1e-16)
          Length = 824

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 16/48 (33%), Positives = 31/48 (64%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSH 680
           GIP + ++D G  F+S + +Q  + +G  H+ +SP +P+  G +ER++
Sbjct: 613 GIPDLAVSDNGPQFASNLYEQFAKDYGFTHVTSSPLYPRANGEVERAN 660


>SB_37630| Best HMM Match : rve (HMM E-Value=4e-24)
          Length = 442

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 22/57 (38%), Positives = 31/57 (54%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRS 653
           G PK + TD G  F + +++      GI+    SP  P T G +ERS+ T KE LR+
Sbjct: 246 GYPKKLNTDNGLEFKNRLVEAFAEKIGIQFSHCSPRTPTTQGLVERSNRTFKEDLRA 302


>SB_34864| Best HMM Match : rve (HMM E-Value=2.9e-16)
          Length = 304

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L+    
Sbjct: 128 GIPDKLVTGHDTQFTSALFKGFSSTYGFIHTTTSPYYKEANGFIERNVQTVKDLLQKCKE 187

Query: 643 ENQ--HTWDLYLRTAMLAY 593
             Q  H   L LRT  L +
Sbjct: 188 SGQDPHLAMLCLRTTPLGH 206


>SB_25327| Best HMM Match : rve (HMM E-Value=6.6e-22)
          Length = 319

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFS--------SEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +++D G+ +S        S   K+    +G +H  +SP +PQ+ GA E++  T K
Sbjct: 106 GIPVEVLSDNGSQYSNTRNLFNSSHEFKKFADEWGFRHTTSSPEYPQSNGAAEKAVQTAK 165

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
             L+    +N+  ++      +L Y +      G SP +LL
Sbjct: 166 RILKKAAADNKDPFE-----GLLKYRNTPFDDLGVSPAQLL 201


>SB_15534| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1041

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/93 (31%), Positives = 48/93 (51%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  +++D G  +SS+  +     +GI+H  +SP++ Q+ G  ER    +K+ L     
Sbjct: 849  GIPAQLLSDGGPQYSSKEFEDFVTTYGIEHTLSSPHYAQSNGFGERMVQMVKQILTKCEE 908

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
            +N+   D YL   +L+Y +        SP ELL
Sbjct: 909  KNE---DPYL--GLLSYRTKPVDHNLKSPAELL 936


>SB_12365| Best HMM Match : rve (HMM E-Value=0.00031)
          Length = 290

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFS--------SEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +++D G+ +S        S   K+    +G +H  +SP +PQ+ GA E++  T K
Sbjct: 27  GIPVEVLSDNGSQYSNTRNLFNSSHEFKKFADEWGFRHTTSSPEYPQSNGAAEKAVQTAK 86

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
             L+    +N+  ++      +L Y +      G SP +LL
Sbjct: 87  RILKKAAADNKDPFE-----GLLKYRNTPFDDLGVSPAQLL 122


>SB_58333| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 570

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L+    
Sbjct: 315 GIPDKLVTGHDTQFTSALFKVFSSTYGFIHTTTSPYYKEANGFIERNVQTVKDLLQKCKE 374

Query: 643 ENQ--HTWDLYLRTAMLAY 593
             Q  H   L LRT  L +
Sbjct: 375 SGQDPHLAMLCLRTTPLGH 393


>SB_53337| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 628

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L+    
Sbjct: 359 GIPDKLVTGHDTQFTSALFKVFSSTYGFIHTTTSPYYKEANGFIERNVQTVKDLLQKCKE 418

Query: 643 ENQ--HTWDLYLRTAMLAY 593
             Q  H   L LRT  L +
Sbjct: 419 SGQDPHLAMLCLRTTPLGH 437


>SB_50204| Best HMM Match : rve (HMM E-Value=6.6e-22)
          Length = 800

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFS--------SEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +++D G+ +S        S   K+    +G +H  +SP +PQ+ GA E++  T K
Sbjct: 603 GIPVEVLSDNGSQYSNTRNLFNSSHEFKKFADEWGFRHTTSSPEYPQSNGAAEKAVQTAK 662

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
             L+    +N+  ++      +L Y +      G SP +LL
Sbjct: 663 RILKKAAADNKDPFE-----GLLKYRNTPFDDLGVSPAQLL 698


>SB_34611| Best HMM Match : rve (HMM E-Value=6.6e-22)
          Length = 875

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFS--------SEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +++D G+ +S        S   K+    +G +H  +SP +PQ+ GA E++  T K
Sbjct: 612 GIPVEVLSDNGSQYSNTRNLFNSSHEFKKFADEWGFRHTTSSPEYPQSNGAAEKAVQTAK 671

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
             L+    +N+  ++      +L Y +      G SP +LL
Sbjct: 672 RILKKAAADNKDPFE-----GLLKYRNTPFDDLGVSPAQLL 707


>SB_30291| Best HMM Match : rve (HMM E-Value=5.3e-16)
          Length = 550

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L+    
Sbjct: 357 GIPDKLVTGHDTQFTSALFKVFSSTYGFIHTTTSPYYKEANGFIERNVQTVKDLLQKCKE 416

Query: 643 ENQ--HTWDLYLRTAMLAY 593
             Q  H   L LRT  L +
Sbjct: 417 SGQDPHLAMLCLRTTPLGH 435


>SB_25480| Best HMM Match : rve (HMM E-Value=6.6e-22)
          Length = 373

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFS--------SEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +++D G+ +S        S   K+    +G +H  +SP +PQ+ GA E++  T K
Sbjct: 110 GIPVEVLSDNGSQYSNTRNLFNSSHEFKKFADEWGFRHTTSSPEYPQSNGAAEKAVQTAK 169

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
             L+    +N+  ++      +L Y +      G SP +LL
Sbjct: 170 RILKKAAADNKDPFE-----GLLKYRNTPFDDLGVSPAQLL 205


>SB_24099| Best HMM Match : rve (HMM E-Value=5.3e-16)
          Length = 307

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L+    
Sbjct: 81  GIPDKLVTGHDTQFTSALFKVFSSTYGFIHTTTSPYYKEANGFIERNVQTVKDLLQKCKE 140

Query: 643 ENQ--HTWDLYLRTAMLAY 593
             Q  H   L LRT  L +
Sbjct: 141 SGQDPHLAMLCLRTTPLGH 159


>SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1696

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 25/95 (26%), Positives = 46/95 (48%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  +++D G+ F+SE   +  +  G+KH   +PYHP++    ER   T K    +   
Sbjct: 1514 GLPIHVVSDNGSQFTSEAFDKFMKQNGVKHTTTAPYHPKSNVQAERFVQTFKLAYEA--- 1570

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
              Q      +   +L   +  ++TT  +P +L+ G
Sbjct: 1571 -GQGPPSQIIADFLLKQRNTSNATTQQTPAKLMLG 1604


>SB_16804| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26)
          Length = 921

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L+    
Sbjct: 666 GIPDKLVTGHDTQFTSALFKVFSSTYGFIHTTTSPYYKEANGFIERNVQTVKDLLQKCKE 725

Query: 643 ENQ--HTWDLYLRTAMLAY 593
             Q  H   L LRT  L +
Sbjct: 726 SGQDPHLAMLCLRTTPLGH 744


>SB_16064| Best HMM Match : rve (HMM E-Value=6.6e-22)
          Length = 371

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 8/101 (7%)
 Frame = -1

Query: 823 GIPKIIITDQGANFS--------SEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +++D G+ +S        S   K+    +G +H  +SP +PQ+ GA E++  T K
Sbjct: 241 GIPVEVLSDNGSQYSNTRNLFNSSHEFKKFADEWGFRHTTSSPEYPQSNGAAEKAVQTAK 300

Query: 667 EYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
             L+    +N+  ++      +L Y +      G SP +LL
Sbjct: 301 RILKKAAADNKDPFE-----GLLKYRNTPFDDLGVSPAQLL 336


>SB_13623| Best HMM Match : rve (HMM E-Value=0.00044)
          Length = 203

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 25/95 (26%), Positives = 46/95 (48%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  +++D G+ F+SE   +  +  G+KH   +PYHP++    ER   T K    +   
Sbjct: 21  GLPIHVVSDNGSQFTSEAFDKFMKQNGVKHTTTAPYHPKSNVQAERFVQTFKLAYEA--- 77

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
             Q      +   +L   +  ++TT  +P +L+ G
Sbjct: 78  -GQGPPSQIIADFLLKQRNTSNATTQQTPAKLMLG 111


>SB_11912| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26)
          Length = 1329

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L+    
Sbjct: 1103 GIPDKLVTGHDTQFTSALFKVFSSTYGFIHTTTSPYYKEANGFIERNVQTVKDLLQKCKE 1162

Query: 643  ENQ--HTWDLYLRTAMLAY 593
              Q  H   L LRT  L +
Sbjct: 1163 SGQDPHLAMLCLRTTPLGH 1181


>SB_4516| Best HMM Match : rve (HMM E-Value=6.5)
          Length = 262

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L+    
Sbjct: 7   GIPDKLVTGHDTQFTSALFKGFSSTYGFIHTTTSPYYKEANGFIERNVQTVKDLLQKCKE 66

Query: 643 ENQ--HTWDLYLRTAMLAY 593
             Q  H   L LRT  L +
Sbjct: 67  SGQDPHLAMLCLRTTPLGH 85


>SB_2280| Best HMM Match : RVT_1 (HMM E-Value=1.4e-25)
          Length = 1186

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L+    
Sbjct: 995  GIPDKLVTGHDTQFTSALFKGFSSTYGFIHTTTSPYYKEANGFIERNVQTVKDLLQKCKE 1054

Query: 643  ENQ--HTWDLYLRTAMLAY 593
              Q  H   L LRT  L +
Sbjct: 1055 SGQDPHLAMLCLRTTPLGH 1073


>SB_52774| Best HMM Match : rve (HMM E-Value=2e-17)
          Length = 329

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 8/79 (10%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSS--------EVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           GIP  +I+D G  +S+           KQ    +G +H+ +SP +PQ+ GA ER+  T K
Sbjct: 241 GIPAKVISDNGPQYSNTRNIFSTTHEFKQFAEAWGFQHVTSSPEYPQSNGAAERAVQTAK 300

Query: 667 EYLRSYIVENQHTWDLYLR 611
              +    EN+  ++  L+
Sbjct: 301 RIFKKAAAENKDPFEGLLK 319


>SB_31354| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2286

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 34/135 (25%), Positives = 66/135 (48%), Gaps = 2/135 (1%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI- 647
            G+P+ + ++ G  F++ V +   R +G++H  +S + PQ+ G  E +  T K  L S   
Sbjct: 1272 GVPEELSSEGGPEFTAGVTQDFLRAWGVRHRVSSAHFPQSNGRAEVAVKTAKRLLMSNTG 1331

Query: 646  VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD-YIRA 470
                   D +LR AML   +        SP +++FG +P     +    L  +S+ ++R 
Sbjct: 1332 PTGSLDHDRFLR-AMLQLRNTPDPDCNVSPAQIIFG-RPLRNTLLFVNRLEKFSNPHVRP 1389

Query: 469  LNHRLYYSRQKALQN 425
            L    + +++ AL++
Sbjct: 1390 LWREAWAAKEDALRS 1404



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 1/96 (1%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI- 647
           G+P+ + ++ G  F++ V +   R +G++H  +S + PQ+ G  E +  T K  L S   
Sbjct: 689 GVPEELSSEGGPEFTAVVTQDFLRAWGVRHRVSSAHFPQSNGRAEVAVKTAKRLLMSNTG 748

Query: 646 VENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
                  D +LR AML   +        SP +++FG
Sbjct: 749 PTGSLDHDRFLR-AMLQLRNTPDPDCNVSPAQIIFG 783


>SB_17624| Best HMM Match : rve (HMM E-Value=2.2e-11)
          Length = 1213

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 39/134 (29%), Positives = 65/134 (48%), Gaps = 2/134 (1%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+P  I ++ G  F++   +   RL+GIKH  +S   PQ+ G  E +  T K  L S   
Sbjct: 872  GVPTEISSNGGPEFTAGGTETFLRLWGIKHRLSSVGFPQSNGRAEVAVKTAKRLLMSNTG 931

Query: 643  EN-QHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD-YIRA 470
             N     D +LR AML   +        SP +++FG +P     +    L  +S+ +IR 
Sbjct: 932  PNGSLDNDRFLR-AMLQLRNTPDRDCDLSPAQIIFG-RPLRDSLMFVNRLEKFSNPHIRP 989

Query: 469  LNHRLYYSRQKALQ 428
            L  + + +++ AL+
Sbjct: 990  LWRQAWAAKEDALR 1003


>SB_10923| Best HMM Match : rve (HMM E-Value=0.0014)
          Length = 147

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 17/47 (36%), Positives = 28/47 (59%)
 Frame = -1

Query: 808 IITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           +++D G+ F+SE   +  +  G+KH   +PYHP++ G  ER   T K
Sbjct: 26  VVSDNGSQFTSEAFDKFMKQNGVKHTTTAPYHPKSNGQAERFVQTFK 72


>SB_58621| Best HMM Match : RVT_1 (HMM E-Value=1.5e-25)
          Length = 1238

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 30/93 (32%), Positives = 44/93 (47%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            GIP  ++T     F+S + K     +G  H   SPY+ +  G +ER+  T+K+ L+    
Sbjct: 983  GIPDKLVTGHDTQFTSALFKVFSSTYGFIHTTTSPYYKEANGFIERNVQTVKDLLQKCKE 1042

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELL 545
              Q   D +L  AML   +     T  SP ELL
Sbjct: 1043 SGQ---DPHL--AMLCLRTTPLGQTLPSPAELL 1070


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,493,407
Number of Sequences: 59808
Number of extensions: 456424
Number of successful extensions: 2080
Number of sequences better than 10.0: 487
Number of HSP's better than 10.0 without gapping: 1839
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2014
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2311562737
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).