SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0037
         (740 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_42080| Best HMM Match : DUF947 (HMM E-Value=3.2)                    30   1.7  
SB_49425| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.7  
SB_105| Best HMM Match : No HMM Matches (HMM E-Value=.)                30   2.3  
SB_28525| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.3  
SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.0  
SB_27880| Best HMM Match : Activin_recp (HMM E-Value=5.1)              29   5.2  
SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   5.2  
SB_54860| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.2  
SB_10048| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.2  
SB_55819| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.9  
SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022)                 28   9.1  
SB_18161| Best HMM Match : Fz (HMM E-Value=4e-05)                      28   9.1  
SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.1  
SB_1771| Best HMM Match : Fz (HMM E-Value=0.00021)                     28   9.1  

>SB_42080| Best HMM Match : DUF947 (HMM E-Value=3.2)
          Length = 274

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 2/80 (2%)
 Frame = -3

Query: 729 YIPIYIRETYIHADIHTRDIHTYRYT*RYKQSFLVENSKDIKQDKPETI*IYNNLANPSL 550
           ++ + +R+TY      TR++++      +K   L++  K+ +QD  +T  +Y+N  NP+ 
Sbjct: 200 HLLLKVRKTYQQDIRDTREVNS-----NFKVHLLLKVRKNDQQDIRDTREVYSNFTNPTD 254

Query: 549 RPEGKH--HLNRFYEMCGFF 496
           R +  H    N  +E   FF
Sbjct: 255 RGKWLHISDFNEKHESARFF 274


>SB_49425| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 429

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 6/67 (8%)
 Frame = +1

Query: 529 MMFTFRSQRWVSQIIVY--SDCLRFVLFDVFAILYEETLLISLCIP----VCMYVSRMYI 690
           +M+T  + R+V  + V   + C+R V+  V+A  Y  ++ +SLC      V   V    +
Sbjct: 346 VMYTVYACRYVHSVCVSLCAQCMRVVMCTVYACRYVHSVCVSLCAQCVRVVMCTVCACRL 405

Query: 691 GMYVCLS 711
           G  VC+S
Sbjct: 406 GHSVCVS 412



 Score = 29.9 bits (64), Expect = 2.3
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 8/78 (10%)
 Frame = +1

Query: 529 MMFTFRSQRWVSQIIVY--SDCLRFVLFDVFAILYEETLLISLC------IPVCMYVSRM 684
           +M T  + R+V  + V   + C+R V+  V A  Y  ++ +SLC      + + +Y   M
Sbjct: 288 VMCTVCASRYVHSVCVSLCTQCMRVVMCTVCACRYIHSVCVSLCAQSVRVVKITVYAVVM 347

Query: 685 YIGMYVCLSYVYRYVCMS 738
           Y  +Y C  YV+  VC+S
Sbjct: 348 YT-VYAC-RYVHS-VCVS 362


>SB_105| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2982

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 3/39 (7%)
 Frame = -2

Query: 181  SPGGTAADHLRAEPVPGDQQSGPQPTAL---LDSYLQNP 74
            SPG  A DH    P P        PT++   +D Y Q P
Sbjct: 1531 SPGPPATDHTHQPPAPSHMDDHTHPTSVPSHMDGYTQTP 1569


>SB_28525| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 467

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 3/39 (7%)
 Frame = -2

Query: 181 SPGGTAADHLRAEPVPGDQQSGPQPTAL---LDSYLQNP 74
           SPG  A DH    P P        PT++   +D Y Q P
Sbjct: 203 SPGPPATDHTHQPPAPSHMDDHTHPTSVPSHMDGYTQTP 241


>SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1480

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 638  CLYRYVYRYVCMSLVCISACMYVSRMYIGMYVC 736
            CL+  VY  V   L C+SAC+++S + +  +VC
Sbjct: 1304 CLFACVYPSVSRVLTCLSACVHLS-VRVCSHVC 1335


>SB_27880| Best HMM Match : Activin_recp (HMM E-Value=5.1)
          Length = 415

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 9/25 (36%), Positives = 16/25 (64%)
 Frame = -3

Query: 738 RHTYIPIYIRETYIHADIHTRDIHT 664
           +H Y  +Y   T++H  +HT++I T
Sbjct: 73  KHAYKCLYTPRTFLHVSVHTKNIPT 97



 Score = 27.9 bits (59), Expect = 9.1
 Identities = 8/25 (32%), Positives = 17/25 (68%)
 Frame = -3

Query: 738 RHTYIPIYIRETYIHADIHTRDIHT 664
           +H+Y  +Y   T++H  ++T++I T
Sbjct: 321 KHSYTGLYTPRTFLHVSVYTKNIPT 345


>SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 200

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 19/66 (28%), Positives = 30/66 (45%)
 Frame = -2

Query: 307 GRGRAAVSGDARPMYTVHAPTACGWCASRHSPARCRGATNSASPGGTAADHLRAEPVPGD 128
           G  R  + G   P    +A  + GW   R + +    +   A+ GGT+ADH R   + G 
Sbjct: 10  GERRTGIRGT--PRVIPNASVSTGWTTVRVTTSGMSDSCALAAIGGTSADHARV-TLFGF 66

Query: 127 QQSGPQ 110
           ++  PQ
Sbjct: 67  ERHAPQ 72


>SB_54860| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 216

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 13/37 (35%), Positives = 17/37 (45%)
 Frame = -1

Query: 326 CSCRICXXXXXXXXXXXSAHVHGPRADRVRLVCEQTQ 216
           C+CR+              +VHGP A  V  VC +TQ
Sbjct: 33  CACRVISMGTDPLRMSRHEYVHGPIAHVVSSVCARTQ 69


>SB_10048| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 547

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 2/33 (6%)
 Frame = +3

Query: 138 TGSARRWSAAVPPGLAEF--VAPLQRAGLCLLA 230
           TGS +R    +PP +A F  V+PL  A  CLLA
Sbjct: 159 TGSIQRQLNLLPPAIASFLAVSPLGTAQKCLLA 191


>SB_55819| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2408

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 12/32 (37%), Positives = 21/32 (65%)
 Frame = -3

Query: 687  IHTRDIHTYRYT*RYKQSFLVENSKDIKQDKP 592
            +H  D  T+R   R++++FLV N + I +D+P
Sbjct: 1360 VHAADALTFRE--RFQKNFLVPNEEKISEDEP 1389



 Score = 28.3 bits (60), Expect = 6.9
 Identities = 12/59 (20%), Positives = 31/59 (52%)
 Frame = +1

Query: 556  WVSQIIVYSDCLRFVLFDVFAILYEETLLISLCIPVCMYVSRMYIGMYVCLSYVYRYVC 732
            ++ +I+ Y   +   L +    L + T+ +S C  + +Y++R+++G+Y        ++C
Sbjct: 1622 YICRIVSYLCRIVMSLSECTVSLSDCTVPLSACTVLLLYLNRIFVGLYRTFVIFEPFIC 1680


>SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022)
          Length = 1421

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 19/61 (31%), Positives = 24/61 (39%)
 Frame = -2

Query: 280 DARPMYTVHAPTACGWCASRHSPARCRGATNSASPGGTAADHLRAEPVPGDQQSGPQPTA 101
           DAR    V A +      S H  +     T + SPGG      R +  P D Q   QP+ 
Sbjct: 385 DARMRCDVSAVSGSLSSVSGHPQSNRESLTPAVSPGGEREPRARVKSAPSDSQH-KQPSI 443

Query: 100 L 98
           L
Sbjct: 444 L 444


>SB_18161| Best HMM Match : Fz (HMM E-Value=4e-05)
          Length = 163

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 11/16 (68%), Positives = 12/16 (75%)
 Frame = -3

Query: 546 PEGKHHLNRFYEMCGF 499
           PEGKH+L R YE  GF
Sbjct: 140 PEGKHYLERCYEPNGF 155


>SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 371

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 12/36 (33%), Positives = 21/36 (58%)
 Frame = +1

Query: 601 LFDVFAILYEETLLISLCIPVCMYVSRMYIGMYVCL 708
           L DV + +++E LL+ LC  V ++ S     + VC+
Sbjct: 238 LLDVHSKMHKEALLVFLCCAVSVWASENTSSVVVCV 273


>SB_1771| Best HMM Match : Fz (HMM E-Value=0.00021)
          Length = 163

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 11/16 (68%), Positives = 12/16 (75%)
 Frame = -3

Query: 546 PEGKHHLNRFYEMCGF 499
           PEGKH+L R YE  GF
Sbjct: 140 PEGKHYLERCYEPNGF 155


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,460,150
Number of Sequences: 59808
Number of extensions: 474543
Number of successful extensions: 1605
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 1339
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1598
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1998111622
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).