SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0036
         (830 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_8898| Best HMM Match : WSC (HMM E-Value=6.4)                        29   4.6  
SB_19621| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.1  
SB_28307| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.1  
SB_2011| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   8.1  

>SB_8898| Best HMM Match : WSC (HMM E-Value=6.4)
          Length = 165

 Score = 29.1 bits (62), Expect = 4.6
 Identities = 17/49 (34%), Positives = 24/49 (48%)
 Frame = +2

Query: 311 RVLARLTNSNSFLYI*IEDRFRYYALFISLM*LC*VNSYHTRSRQRSIW 457
           RV  R     SFL+I  +  ++Y+     L   C V  YH R R+R +W
Sbjct: 35  RVCRRYRYCKSFLFIKHKCHYKYHCY---LKCSCKVKYYHCRYRRRCVW 80


>SB_19621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 730

 Score = 28.7 bits (61), Expect = 6.1
 Identities = 11/41 (26%), Positives = 24/41 (58%)
 Frame = +3

Query: 507 VLARQQPQLLSIRSRTKRSPVRTPSRSRLIGNYALYNLSQP 629
           +L++ +PQ   I       P  TP+ ++LIG ++++ + +P
Sbjct: 525 LLSQPEPQASPIHQMVLYRPSPTPNTAQLIGQFSVHQVKRP 565


>SB_28307| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 761

 Score = 28.3 bits (60), Expect = 8.1
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = +3

Query: 408 CVE*ILITHEADRDPFG*LATTPFRLYLRHVSGVLARQQPQLLSI 542
           CV    +T E+D  P   + T P R  L+ + G+L + Q   ++I
Sbjct: 422 CVYGREVTVESDHKPLAAIVTKPLRSALKRLQGMLLKMQRYCVTI 466


>SB_2011| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 239

 Score = 28.3 bits (60), Expect = 8.1
 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 2/35 (5%)
 Frame = +2

Query: 293 NRSSRFRVLARLTNSNSFL--YI*IEDRFRYYALF 391
           +R S +RVL RLTN++S L  Y  +EDR     +F
Sbjct: 190 SRESDWRVLLRLTNTDSCLGDYTIVEDRVSLIMMF 224


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,368,483
Number of Sequences: 59808
Number of extensions: 494824
Number of successful extensions: 1032
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 962
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1031
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2335516755
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).