SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0035
         (754 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.)              90   2e-18
SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0)                       89   3e-18
SB_26005| Best HMM Match : No HMM Matches (HMM E-Value=.)              89   5e-18
SB_17390| Best HMM Match : Exo_endo_phos (HMM E-Value=3.1e-13)         88   6e-18
SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0)                       88   6e-18
SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.)               88   8e-18
SB_53389| Best HMM Match : Exo_endo_phos (HMM E-Value=6.3e-10)         87   2e-17
SB_53800| Best HMM Match : No HMM Matches (HMM E-Value=.)              85   4e-17
SB_22068| Best HMM Match : No HMM Matches (HMM E-Value=.)              82   5e-16
SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43)              81   7e-16
SB_36088| Best HMM Match : RVT_1 (HMM E-Value=9e-12)                   81   9e-16
SB_34129| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=4.7)            81   9e-16
SB_27268| Best HMM Match : RVT_1 (HMM E-Value=2.24208e-44)             81   9e-16
SB_47788| Best HMM Match : Cir_Bir_Yir (HMM E-Value=8.6)               80   2e-15
SB_20258| Best HMM Match : Exo_endo_phos (HMM E-Value=7.1e-16)         80   2e-15
SB_50373| Best HMM Match : HC2 (HMM E-Value=0.001)                     77   2e-14
SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.)              76   3e-14
SB_35013| Best HMM Match : Exo_endo_phos (HMM E-Value=0.027)           74   1e-13
SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.)               73   2e-13
SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.)              73   2e-13
SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13)                  73   2e-13
SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43)             73   3e-13
SB_798| Best HMM Match : No HMM Matches (HMM E-Value=.)                73   3e-13
SB_59377| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7)             73   3e-13
SB_35561| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00092)         73   3e-13
SB_25245| Best HMM Match : No HMM Matches (HMM E-Value=.)              73   3e-13
SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044)         73   3e-13
SB_48325| Best HMM Match : No HMM Matches (HMM E-Value=.)              72   4e-13
SB_28802| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00055)         72   4e-13
SB_10116| Best HMM Match : RVT_1 (HMM E-Value=2.5e-33)                 72   4e-13
SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11)                 71   8e-13
SB_42532| Best HMM Match : Exo_endo_phos (HMM E-Value=7.2e-16)         71   8e-13
SB_63| Best HMM Match : RVT_1 (HMM E-Value=0)                          71   1e-12
SB_21614| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-41)             70   2e-12
SB_3348| Best HMM Match : Borrelia_orfA (HMM E-Value=0.71)             70   2e-12
SB_10251| Best HMM Match : RVT_1 (HMM E-Value=0.0022)                  67   1e-11
SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12)                 66   2e-11
SB_3024| Best HMM Match : No HMM Matches (HMM E-Value=.)               66   2e-11
SB_39386| Best HMM Match : RVT_1 (HMM E-Value=7.1e-28)                 66   3e-11
SB_20189| Best HMM Match : No HMM Matches (HMM E-Value=.)              65   5e-11
SB_33083| Best HMM Match : No HMM Matches (HMM E-Value=.)              65   7e-11
SB_45005| Best HMM Match : RVT_1 (HMM E-Value=6.6e-32)                 64   9e-11
SB_48818| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00029)         64   2e-10
SB_52862| Best HMM Match : No HMM Matches (HMM E-Value=.)              63   2e-10
SB_8360| Best HMM Match : RVT_1 (HMM E-Value=3.6e-07)                  62   4e-10
SB_6162| Best HMM Match : No HMM Matches (HMM E-Value=.)               61   8e-10
SB_49549| Best HMM Match : RVT_1 (HMM E-Value=3.6e-11)                 61   1e-09
SB_9264| Best HMM Match : DnaD (HMM E-Value=1.3)                       61   1e-09
SB_28047| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_31418| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0)                       60   2e-09
SB_58171| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   3e-09
SB_56469| Best HMM Match : Exo_endo_phos (HMM E-Value=1.2e-12)         60   3e-09
SB_17727| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-12)         60   3e-09
SB_27891| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   3e-09
SB_43796| Best HMM Match : SH2 (HMM E-Value=6.4)                       59   4e-09
SB_799| Best HMM Match : No HMM Matches (HMM E-Value=.)                58   6e-09
SB_13020| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   6e-09
SB_53688| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   8e-09
SB_37633| Best HMM Match : DUF327 (HMM E-Value=2.1)                    58   8e-09
SB_10952| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-08)         58   1e-08
SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061)                   57   1e-08
SB_12999| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-10)         57   2e-08
SB_56617| Best HMM Match : RVT_1 (HMM E-Value=0.04)                    56   3e-08
SB_48302| Best HMM Match : HORMA (HMM E-Value=1.1)                     56   4e-08
SB_54849| Best HMM Match : HORMA (HMM E-Value=0.54)                    56   4e-08
SB_54673| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   5e-08
SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   7e-08
SB_38561| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4)             54   1e-07
SB_26795| Best HMM Match : Exo_endo_phos (HMM E-Value=6.3e-10)         54   2e-07
SB_20796| Best HMM Match : RVT_1 (HMM E-Value=0.047)                   54   2e-07
SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08)                   52   4e-07
SB_21074| Best HMM Match : NadA (HMM E-Value=2)                        52   4e-07
SB_28351| Best HMM Match : Exo_endo_phos (HMM E-Value=0.041)           52   4e-07
SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0)                       52   5e-07
SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34)                 52   5e-07
SB_9596| Best HMM Match : BAF (HMM E-Value=1.54143e-44)                52   5e-07
SB_22732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-23)                 52   7e-07
SB_21644| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   7e-07
SB_36459| Best HMM Match : FlgN (HMM E-Value=2.2)                      51   1e-06
SB_29863| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   1e-06
SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42)             50   2e-06
SB_17745| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   2e-06
SB_12862| Best HMM Match : Ribosomal_S6 (HMM E-Value=3)                50   2e-06
SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   2e-06
SB_18820| Best HMM Match : FCH (HMM E-Value=5.4e-20)                   50   3e-06
SB_50658| Best HMM Match : Pox_D2 (HMM E-Value=4.7)                    49   4e-06
SB_39669| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   5e-06
SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43)             49   5e-06
SB_12012| Best HMM Match : DUF327 (HMM E-Value=2)                      49   5e-06
SB_51484| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0036)          49   5e-06
SB_49126| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   5e-06
SB_29903| Best HMM Match : SAP (HMM E-Value=2.2e-11)                   49   5e-06
SB_27446| Best HMM Match : Peptidase_C21 (HMM E-Value=2.7)             49   5e-06
SB_5806| Best HMM Match : No HMM Matches (HMM E-Value=.)               49   5e-06
SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20)                 48   6e-06
SB_20167| Best HMM Match : RhoGEF (HMM E-Value=0.73)                   48   6e-06
SB_3901| Best HMM Match : PkinA_anch (HMM E-Value=2.4)                 48   6e-06
SB_59383| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   8e-06
SB_59320| Best HMM Match : Exo_endo_phos (HMM E-Value=0.29)            48   1e-05
SB_3604| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   1e-05
SB_49192| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   1e-05
SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0)                       47   1e-05
SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   1e-05
SB_53821| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   2e-05
SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1)                      47   2e-05
SB_48398| Best HMM Match : BBE (HMM E-Value=4.1)                       46   2e-05
SB_30943| Best HMM Match : Exo_endo_phos (HMM E-Value=4.7e-05)         46   2e-05
SB_6691| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0031)           46   2e-05
SB_32796| Best HMM Match : MSG (HMM E-Value=2.7)                       46   3e-05
SB_30907| Best HMM Match : THAP (HMM E-Value=0.0033)                   46   3e-05
SB_58999| Best HMM Match : Exo_endo_phos (HMM E-Value=2.6)             46   3e-05
SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   3e-05
SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   3e-05
SB_25416| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   3e-05
SB_25856| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.4)           45   6e-05
SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25)                 45   6e-05
SB_1713| Best HMM Match : No HMM Matches (HMM E-Value=.)               45   6e-05
SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   8e-05
SB_8718| Best HMM Match : Lipase_GDSL (HMM E-Value=0.023)              45   8e-05
SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   8e-05
SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   8e-05
SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12)                 45   8e-05
SB_21418| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_58944| Best HMM Match : fn3 (HMM E-Value=0.88)                      44   1e-04
SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.)               44   1e-04
SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25)                   44   1e-04
SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29)                  44   2e-04
SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_14165| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_56872| Best HMM Match : RVT_1 (HMM E-Value=2.7e-30)                 43   2e-04
SB_25574| Best HMM Match : Gp-FAR-1 (HMM E-Value=1.9)                  43   2e-04
SB_10446| Best HMM Match : Exo_endo_phos (HMM E-Value=6.6e-20)         43   2e-04
SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_36163| Best HMM Match : RVT_1 (HMM E-Value=4.2e-11)                 43   2e-04
SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23)                 43   2e-04
SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07)                   43   3e-04
SB_27477| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_52393| Best HMM Match : LEA_4 (HMM E-Value=8)                       43   3e-04
SB_41523| Best HMM Match : bZIP_1 (HMM E-Value=8.8)                    43   3e-04
SB_25123| Best HMM Match : LEA_4 (HMM E-Value=8)                       43   3e-04
SB_21205| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.75)          42   4e-04
SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064)                    42   4e-04
SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14)                 42   4e-04
SB_8907| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   4e-04
SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1)                     42   5e-04
SB_34358| Best HMM Match : DUF1280 (HMM E-Value=7)                     42   5e-04
SB_43156| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   7e-04
SB_33113| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   7e-04
SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   7e-04
SB_19845| Best HMM Match : Macscav_rec (HMM E-Value=9.9)               42   7e-04
SB_58486| Best HMM Match : Vicilin_N (HMM E-Value=1.6)                 42   7e-04
SB_55395| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   7e-04
SB_51811| Best HMM Match : Vicilin_N (HMM E-Value=1.9)                 42   7e-04
SB_47673| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   7e-04
SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0)                       42   7e-04
SB_26022| Best HMM Match : DUF1235 (HMM E-Value=4.8)                   42   7e-04
SB_12038| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   7e-04
SB_53870| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   0.001
SB_45315| Best HMM Match : DUF1235 (HMM E-Value=2.3)                   41   0.001
SB_26857| Best HMM Match : Viral_NABP (HMM E-Value=2.6)                41   0.001
SB_24630| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   0.001
SB_4524| Best HMM Match : Ribosomal_S7e (HMM E-Value=0.59)             41   0.001
SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   0.001
SB_41509| Best HMM Match : Exo_endo_phos (HMM E-Value=4.7e-05)         41   0.001
SB_41296| Best HMM Match : RVT_1 (HMM E-Value=2.8e-24)                 41   0.001
SB_55401| Best HMM Match : Flp_N (HMM E-Value=9.2)                     41   0.001
SB_43061| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   0.001
SB_16607| Best HMM Match : Flp_N (HMM E-Value=9.2)                     41   0.001
SB_4695| Best HMM Match : SAM_1 (HMM E-Value=0.012)                    41   0.001
SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05)               40   0.002
SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_4381| Best HMM Match : RVT_1 (HMM E-Value=3)                        40   0.002
SB_13911| Best HMM Match : PAN (HMM E-Value=0.033)                     40   0.002
SB_6009| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.002
SB_20278| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.003
SB_5816| Best HMM Match : RVT_1 (HMM E-Value=3e-16)                    40   0.003
SB_58227| Best HMM Match : HSBP1 (HMM E-Value=0.28)                    40   0.003
SB_17276| Best HMM Match : E-MAP-115 (HMM E-Value=0.57)                40   0.003
SB_52970| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.004
SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.004
SB_11573| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.004
SB_3992| Best HMM Match : No HMM Matches (HMM E-Value=.)               39   0.004
SB_32313| Best HMM Match : RnaseH (HMM E-Value=2.5)                    39   0.004
SB_28679| Best HMM Match : RVT_1 (HMM E-Value=9.3e-08)                 39   0.004
SB_18340| Best HMM Match : Vicilin_N (HMM E-Value=1.5)                 39   0.004
SB_14635| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.004
SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.005
SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33)                 39   0.005
SB_45447| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.007
SB_31815| Best HMM Match : Lipase_GDSL (HMM E-Value=0.0024)            38   0.007
SB_18991| Best HMM Match : RVT_1 (HMM E-Value=2.8e-34)                 38   0.007
SB_2424| Best HMM Match : RVT_1 (HMM E-Value=6.2e-18)                  38   0.007
SB_58397| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.007
SB_53690| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.007
SB_32319| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.007
SB_22944| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.009
SB_10854| Best HMM Match : Hormone_4 (HMM E-Value=8.4)                 38   0.009
SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.)               38   0.009
SB_42535| Best HMM Match : Bac_transf (HMM E-Value=2.7)                38   0.009
SB_27190| Best HMM Match : PAN (HMM E-Value=0.13)                      38   0.009
SB_18097| Best HMM Match : NadA (HMM E-Value=2.2)                      38   0.009
SB_1967| Best HMM Match : ubiquitin (HMM E-Value=4.7e-12)              38   0.012
SB_13896| Best HMM Match : bZIP_1 (HMM E-Value=3.6)                    38   0.012
SB_7667| Best HMM Match : DUF827 (HMM E-Value=0.33)                    38   0.012
SB_6740| Best HMM Match : RVT_1 (HMM E-Value=4.5e-22)                  38   0.012
SB_33535| Best HMM Match : RVT_1 (HMM E-Value=1.4013e-45)              37   0.015
SB_31961| Best HMM Match : EGF (HMM E-Value=0)                         37   0.015
SB_8909| Best HMM Match : LRR_2 (HMM E-Value=0.34)                     37   0.015
SB_53096| Best HMM Match : PHD (HMM E-Value=0.001)                     37   0.015
SB_52564| Best HMM Match : Exo_endo_phos (HMM E-Value=3.2e-09)         37   0.015
SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.015
SB_15517| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05)               37   0.015
SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0)                       37   0.015
SB_51284| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.020
SB_47464| Best HMM Match : RVT_1 (HMM E-Value=0.012)                   37   0.020
SB_35000| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.020
SB_20248| Best HMM Match : GPS (HMM E-Value=1.5)                       37   0.020
SB_16854| Best HMM Match : UL97 (HMM E-Value=4.9)                      37   0.020
SB_46086| Best HMM Match : RVT_1 (HMM E-Value=1.6e-20)                 36   0.027
SB_37654| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.027
SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19)                   36   0.027
SB_25564| Best HMM Match : RVT_1 (HMM E-Value=0.049)                   36   0.027
SB_33292| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.035
SB_27297| Best HMM Match : Bin3 (HMM E-Value=0.074)                    36   0.035
SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8)                    36   0.035
SB_11125| Best HMM Match : Borrelia_orfA (HMM E-Value=2.7)             36   0.035
SB_40322| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27)                 36   0.035
SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.035
SB_19953| Best HMM Match : Trehalase (HMM E-Value=0.66)                36   0.035
SB_21896| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.047
SB_2439| Best HMM Match : No HMM Matches (HMM E-Value=.)               36   0.047
SB_58520| Best HMM Match : RVT_1 (HMM E-Value=0.035)                   36   0.047
SB_50409| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.047
SB_45260| Best HMM Match : RVT_1 (HMM E-Value=1.2)                     36   0.047
SB_3341| Best HMM Match : No HMM Matches (HMM E-Value=.)               36   0.047
SB_58998| Best HMM Match : PkinA_anch (HMM E-Value=1.8)                35   0.062
SB_54431| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.062
SB_32586| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.062
SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0)                       35   0.062
SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14)                   35   0.062
SB_24103| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.062
SB_23376| Best HMM Match : GPS (HMM E-Value=1.2)                       35   0.062
SB_57968| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.082
SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05)                   35   0.082
SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36)                  35   0.082
SB_4188| Best HMM Match : 7tm_1 (HMM E-Value=9e-06)                    35   0.082
SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.082
SB_58879| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.11 
SB_48808| Best HMM Match : DEAD (HMM E-Value=0.029)                    34   0.11 
SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11)                 34   0.11 
SB_45778| Best HMM Match : Exo_endo_phos (HMM E-Value=1e-10)           34   0.11 
SB_39714| Best HMM Match : Lipin_N (HMM E-Value=0)                     34   0.11 
SB_38793| Best HMM Match : RepA_N (HMM E-Value=3.4)                    34   0.11 
SB_22901| Best HMM Match : PHD (HMM E-Value=5.3e-05)                   34   0.11 
SB_17137| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.11 
SB_12043| Best HMM Match : RVT_1 (HMM E-Value=3.1)                     34   0.11 
SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.11 
SB_28723| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.11 
SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.11 
SB_31184| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.14 
SB_19445| Best HMM Match : DUF104 (HMM E-Value=7.3)                    34   0.14 
SB_18309| Best HMM Match : Exo_endo_phos (HMM E-Value=2.3e-09)         34   0.14 
SB_45671| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.14 
SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0)                        33   0.19 
SB_4338| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.19 
SB_576| Best HMM Match : RVT_1 (HMM E-Value=0)                         33   0.19 
SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.19 
SB_38448| Best HMM Match : Exo_endo_phos (HMM E-Value=1.2e-12)         33   0.19 
SB_36722| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.19 
SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.19 
SB_51001| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.25 
SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.25 
SB_59555| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.33 
SB_51839| Best HMM Match : Gp-FAR-1 (HMM E-Value=2)                    33   0.33 
SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26)                 33   0.33 
SB_27204| Best HMM Match : RVT_1 (HMM E-Value=0.00085)                 33   0.33 
SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0)                        33   0.33 
SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0)                       33   0.33 
SB_45895| Best HMM Match : RVT_1 (HMM E-Value=0.00031)                 33   0.33 
SB_27722| Best HMM Match : RVT_1 (HMM E-Value=0.00011)                 33   0.33 
SB_22389| Best HMM Match : RVT_1 (HMM E-Value=1.6e-37)                 33   0.33 
SB_2306| Best HMM Match : MecA_N (HMM E-Value=2.3)                     33   0.33 
SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26)                 32   0.43 
SB_21551| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0016)          32   0.43 
SB_21517| Best HMM Match : UCR_UQCRX_QCR9 (HMM E-Value=7.2)            32   0.43 
SB_48371| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.43 
SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21)                 32   0.43 
SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28)                    32   0.43 
SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.57 
SB_50655| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.57 
SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21)                 32   0.57 
SB_56077| Best HMM Match : Exo_endo_phos (HMM E-Value=0.55)            32   0.57 
SB_22736| Best HMM Match : F5_F8_type_C (HMM E-Value=6.4e-24)          31   0.76 
SB_9994| Best HMM Match : SspO (HMM E-Value=0.39)                      31   0.76 
SB_8984| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   0.76 
SB_43483| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33)                 31   0.76 
SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.76 
SB_31795| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40)                 31   1.0  
SB_24441| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0)                       31   1.0  
SB_2344| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.0  
SB_58114| Best HMM Match : DUF1478 (HMM E-Value=3)                     31   1.0  
SB_57858| Best HMM Match : RNA_pol_A_CTD (HMM E-Value=5.7)             31   1.0  
SB_54198| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076)         31   1.0  
SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0)                       31   1.0  
SB_17341| Best HMM Match : RVT_1 (HMM E-Value=0.063)                   31   1.0  
SB_56123| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.3  
SB_50861| Best HMM Match : Borrelia_orfA (HMM E-Value=4.4)             31   1.3  
SB_40407| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33)                 31   1.3  
SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0)                       31   1.3  
SB_11322| Best HMM Match : Pkinase_C (HMM E-Value=4.1)                 31   1.3  
SB_7753| Best HMM Match : RVT_1 (HMM E-Value=0.089)                    31   1.3  
SB_3270| Best HMM Match : MMPL (HMM E-Value=0.68)                      31   1.3  
SB_49847| Best HMM Match : VAR1 (HMM E-Value=5.2)                      31   1.3  
SB_46946| Best HMM Match : RVT_1 (HMM E-Value=0.7)                     31   1.3  
SB_37732| Best HMM Match : RVT_1 (HMM E-Value=2e-23)                   31   1.3  
SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054)                   31   1.3  
SB_30005| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.3  
SB_15883| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.3  
SB_8835| Best HMM Match : RVT_1 (HMM E-Value=1.2e-36)                  31   1.3  
SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.8  
SB_52896| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0023)          30   2.3  
SB_41660| Best HMM Match : PyrI_C (HMM E-Value=4.6)                    30   2.3  
SB_36989| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.3  
SB_35415| Best HMM Match : BRF1 (HMM E-Value=4.4)                      30   2.3  
SB_29242| Best HMM Match : CIDE-N (HMM E-Value=5)                      30   2.3  
SB_21579| Best HMM Match : Phage_integrase (HMM E-Value=0.96)          30   2.3  
SB_10705| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.3  
SB_41708| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.3  
SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.3  
SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0)                       30   2.3  
SB_21992| Best HMM Match : LRR_1 (HMM E-Value=3.2e-07)                 30   2.3  
SB_20463| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.3  
SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_16136| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0025)          29   3.1  
SB_57036| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_31431| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_21536| Best HMM Match : RVT_1 (HMM E-Value=0.0043)                  29   3.1  
SB_21047| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_16692| Best HMM Match : UBA (HMM E-Value=1.8e-09)                   29   3.1  
SB_13983| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.1  
SB_19322| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.1  
SB_11292| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.1  
SB_59301| Best HMM Match : gpW (HMM E-Value=8.4)                       29   4.1  
SB_47551| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.1  
SB_40027| Best HMM Match : RVT_1 (HMM E-Value=3.8e-11)                 29   4.1  
SB_5026| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   4.1  
SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45)              29   5.4  
SB_59317| Best HMM Match : APT (HMM E-Value=7.8)                       29   5.4  
SB_53562| Best HMM Match : Exo_endo_phos (HMM E-Value=0.018)           29   5.4  
SB_43399| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.4  
SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041)                   29   5.4  
SB_4717| Best HMM Match : Exo_endo_phos (HMM E-Value=0.49)             29   5.4  
SB_4314| Best HMM Match : 4_1_CTD (HMM E-Value=1.8)                    29   5.4  
SB_50753| Best HMM Match : zf-C2H2 (HMM E-Value=0.012)                 29   5.4  
SB_26568| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.4  
SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.4  
SB_19635| Best HMM Match : Met_10 (HMM E-Value=3.4e-13)                29   5.4  
SB_14807| Best HMM Match : RVT_1 (HMM E-Value=2.2)                     29   5.4  
SB_5835| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   5.4  
SB_4888| Best HMM Match : DUF104 (HMM E-Value=7.3)                     29   5.4  
SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06)                   29   5.4  
SB_15909| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.1  
SB_9950| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   7.1  
SB_58162| Best HMM Match : Exo_endo_phos (HMM E-Value=1.2e-14)         28   7.1  
SB_50830| Best HMM Match : RVT_1 (HMM E-Value=0.04)                    28   7.1  
SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.1  
SB_55618| Best HMM Match : RVT_1 (HMM E-Value=0.12)                    28   9.4  
SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0)                       28   9.4  
SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0)                       28   9.4  
SB_38578| Best HMM Match : RVT_1 (HMM E-Value=0.018)                   28   9.4  
SB_50353| Best HMM Match : DREPP (HMM E-Value=2)                       28   9.4  
SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42)             28   9.4  
SB_14171| Best HMM Match : Chitin_synth_2 (HMM E-Value=7.7e-07)        28   9.4  

>SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2362

 Score = 89.8 bits (213), Expect = 2e-18
 Identities = 65/259 (25%), Positives = 114/259 (44%), Gaps = 15/259 (5%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
            R+YK  D  +   D+ N  W  +    +I+D + ++N   + + D HAP++R R+K  P 
Sbjct: 1876 RSYKNFDADSFNDDLRNVPWHIVNSMDDIDDALLTWNQLFLEVADDHAPIKRQRVKGTPI 1935

Query: 569  PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR- 393
            PW+   I   M           +  TE     Y+ LRN+ N+L + +K  Y+   +E   
Sbjct: 1936 PWMNNQISESMKERDIAHRIARKLNTERHWKTYRNLRNKVNKLVKSSKSKYYCDMIEESK 1995

Query: 392  -SPAHTWRFLKSVGIGKTPVSSVK--DTD----------LCALNKHFSLPPVSLSDSSKT 252
                  W+ +      K+   S++   TD            A+N  F+     L+D   T
Sbjct: 1996 GDSGKIWKAVNEACNRKSTSESIQCIITDNIQHITPSSIATAMNCFFASIGQRLADKFTT 2055

Query: 251  ATLLKISSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPI 75
                + SS+S      F+L  +  + V     S+  + A+G+D + ++++     T+AP 
Sbjct: 2056 CKSNQ-SSVSNQTCQ-FQLIELIESFVLEQLLSLKVNKAIGLDKISARLLKNSARTIAPS 2113

Query: 74   LTDIFNFSFTSSNFPDSWK 18
            +T++ N S  S  FP  WK
Sbjct: 2114 ITNMLNLSIRSGKFPKLWK 2132


>SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 630

 Score = 89.4 bits (212), Expect = 3e-18
 Identities = 65/259 (25%), Positives = 114/259 (44%), Gaps = 15/259 (5%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+YK  D  +   D+ N  W  +    +I+D + ++N   + + D HAP++R R+K  P 
Sbjct: 5   RSYKNFDADSFNDDLRNVPWHIVNSMDDIDDALLTWNQFFLEVADDHAPIKRQRVKGTPI 64

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR- 393
           PW+   I   M           +  TE     Y+ LRN+ N+L + +K  Y+   +E   
Sbjct: 65  PWMNNQISESMKERDIAHRIARKLNTERHWKTYRNLRNKVNKLVKSSKSKYYCDMIEESK 124

Query: 392 -SPAHTWRFLKSVGIGKTPVSSVK--DTD----------LCALNKHFSLPPVSLSDSSKT 252
                 W+ +      K+   S++   TD            A+N  F+     L+D   T
Sbjct: 125 GDSGKIWKAVNEACNRKSTSESIQCIITDNIQHITPSSIATAMNCFFASIGQRLADKFTT 184

Query: 251 ATLLKISSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPI 75
               + SS+S      F+L  +  + V     S+  + A+G+D + ++++     T+AP 
Sbjct: 185 CKSNQ-SSVSNQTCQ-FQLIELIESFVLEQLLSLKVNKAIGLDKISARLLKNSARTIAPS 242

Query: 74  LTDIFNFSFTSSNFPDSWK 18
           +T++ N S  S  FP  WK
Sbjct: 243 ITNMLNLSIRSGKFPKLWK 261


>SB_26005| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 947

 Score = 88.6 bits (210), Expect = 5e-18
 Identities = 68/250 (27%), Positives = 115/250 (46%), Gaps = 4/250 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+ K +D  A  +D++   WS +    +++D V+ +N   +S+ D HAP+ R R+K +  
Sbjct: 115 RDCKKLDEEAFLKDLDEAPWSVLDTFDDLDDAVDYWNVTFLSIADIHAPLIRKRVKKQSQ 174

Query: 569 P-WLTPDIKTLMXXXXXXXXXXXRCPTE-HSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
           P W+TP++   +           +C ++  +   +K+ RN   +  ++AKR +F+KS E 
Sbjct: 175 PQWMTPELYAAIRDRDRLLERARKCNSDSDAWETFKSARNNVFQSIQEAKRNHFNKSFEQ 234

Query: 395 RSPA-HTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSV 219
            S A   WR LK + IG+T   S       A N     P ++     K   L        
Sbjct: 235 SSTAKEFWRHLK-IAIGQTSKPSPSQLRGNASN----TPTITDPHFEK---LKGFVDSKT 286

Query: 218 PRIPIFELSPVSVADVRNSFFSISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTS 42
           P    FE+  V    V+     + +  A G+D + ++++    P +AP LT I N S  +
Sbjct: 287 PSGTKFEIPKVMQEFVQGYLLQLQTCKATGLDGISARLLRAAAPAIAPSLTKIINQSIKT 346

Query: 41  SNFPDSWKPA 12
             FP   K A
Sbjct: 347 GRFPARLKEA 356


>SB_17390| Best HMM Match : Exo_endo_phos (HMM E-Value=3.1e-13)
          Length = 851

 Score = 88.2 bits (209), Expect = 6e-18
 Identities = 73/265 (27%), Positives = 120/265 (45%), Gaps = 18/265 (6%)
 Frame = -3

Query: 752  LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
            +RN+K  D     +D+    W  I+  H+ N+M   +    +++ D+HAPV+  R K   
Sbjct: 580  IRNFKHFDQQKFVKDLLTQSWEQIVLCHDTNEMWAHWKDLFLNVLDRHAPVQSKRKKAFN 639

Query: 572  APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR 393
             PWLT +IK L+                +    +KA RN+ N   R AK  Y+   + N+
Sbjct: 640  VPWLTREIKDLINNRDKLKRKAMVSKLRNDWDDFKASRNKVNIALRQAKSNYYRNKIANQ 699

Query: 392  --SPAHTWRFLKSVGIGK----TPVSSVKDTDLC---------ALNKHFSL--PPVSLSD 264
              +P   W+ + S+ +G+    T V+ +K  D           A N +FS   P ++ S 
Sbjct: 700  KNNPKEAWKTINSL-LGRTKENTTVNELKFDDQSLFSQEHIAEAFNDYFSNVGPKLASSM 758

Query: 263  SSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISST-AVGIDNVCSKMIALILPT 87
            ++ + +          ++  F+L  VS   V      +S+  A GID +  K++      
Sbjct: 759  ANPSKSFEHFIKPCSAQMSRFKL--VSNTKVLKLLGCLSNAKATGIDKISGKILKCAAHA 816

Query: 86   VAPILTDIFNFSFTSSNFPDSWKPA 12
            ++P LT IFN S  S+ FPD WK A
Sbjct: 817  ISPSLTYIFNNSIISNCFPDEWKMA 841


>SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 940

 Score = 88.2 bits (209), Expect = 6e-18
 Identities = 73/265 (27%), Positives = 120/265 (45%), Gaps = 18/265 (6%)
 Frame = -3

Query: 752  LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
            +RN+K  D     +D+    W  I+  H+ N+M   +    +++ D+HAPV+  R K   
Sbjct: 229  IRNFKHFDQQKFVKDLLTQSWEQIVLCHDTNEMWAHWKDLFLNVLDRHAPVQSKRKKAFN 288

Query: 572  APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR 393
             PWLT +IK L+                +    +KA RN+ N   R AK  Y+   + N+
Sbjct: 289  VPWLTREIKDLINNRDKLKRKAMVSKLRNDWDDFKASRNKVNIALRQAKSNYYRNKIANQ 348

Query: 392  --SPAHTWRFLKSVGIGK----TPVSSVKDTDLC---------ALNKHFSL--PPVSLSD 264
              +P   W+ + S+ +G+    T V+ +K  D           A N +FS   P ++ S 
Sbjct: 349  KNNPKEAWKTINSL-LGRTKENTTVNELKFDDQSLFSQEHIAEAFNDYFSNVGPKLASSM 407

Query: 263  SSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISST-AVGIDNVCSKMIALILPT 87
            ++ + +          ++  F+L  VS   V      +S+  A GID +  K++      
Sbjct: 408  ANPSKSFEHFIKPCSAQMSRFKL--VSNTKVLKLLGCLSNAKATGIDKISGKILKCAAHA 465

Query: 86   VAPILTDIFNFSFTSSNFPDSWKPA 12
            ++P LT IFN S  S+ FPD WK A
Sbjct: 466  ISPSLTYIFNNSIISNCFPDEWKMA 490


>SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1457

 Score = 87.8 bits (208), Expect = 8e-18
 Identities = 73/265 (27%), Positives = 119/265 (44%), Gaps = 18/265 (6%)
 Frame = -3

Query: 752  LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
            +RN+K  D     +D+    W  I+  H+ N+M   +    +++ D+HAPV   R K   
Sbjct: 426  IRNFKHFDQQKFVKDLLTQSWEQIVLCHDTNEMWAHWKDLFLNVLDRHAPVESKRKKAFN 485

Query: 572  APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR 393
             PWLT +IK L+                +    +KA RN+ N   R AK  Y+   + N+
Sbjct: 486  VPWLTREIKDLINNRDKLKRKAMVSKLRNDWDDFKASRNKVNIALRQAKSNYYRNKIANQ 545

Query: 392  --SPAHTWRFLKSVGIGK----TPVSSVKDTDLC---------ALNKHFSL--PPVSLSD 264
              +P   W+ + S+ +G+    T V+ +K  D           A N +FS   P ++ S 
Sbjct: 546  KNNPKEAWKTINSL-LGRTKENTTVNELKFDDQSLFSQEHIAEAFNDYFSNVGPKLASSM 604

Query: 263  SSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISST-AVGIDNVCSKMIALILPT 87
            ++ + +          ++  F+L  VS   V      +S+  A GID +  K++      
Sbjct: 605  ANPSKSFEHFIKPCSAQMSRFKL--VSNTKVLKLLGCLSNAKATGIDKISGKILKCAAHA 662

Query: 86   VAPILTDIFNFSFTSSNFPDSWKPA 12
            ++P LT IFN S  S+ FPD WK A
Sbjct: 663  ISPSLTYIFNNSIISNCFPDEWKMA 687


>SB_53389| Best HMM Match : Exo_endo_phos (HMM E-Value=6.3e-10)
          Length = 774

 Score = 86.6 bits (205), Expect = 2e-17
 Identities = 73/265 (27%), Positives = 120/265 (45%), Gaps = 18/265 (6%)
 Frame = -3

Query: 752  LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
            +RN+K  D     +D+    W  I+  H+ N+M   +    +++ D+HAPV+  R K   
Sbjct: 509  IRNFKHFDQQKFVKDLLTQSWEQIVLCHDTNEMWAHWKDLFLNVLDRHAPVQSKRKKAFN 568

Query: 572  APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR 393
             PWLT +IK L+                +    +KA RN+ N   R AK  Y+   + N+
Sbjct: 569  VPWLTREIKDLINNRDKLKRKAMVSKLRNDWDDFKASRNKVNIALRLAKSNYYRNKIANQ 628

Query: 392  --SPAHTWRFLKSVGIGK----TPVSSVKDTDLC---------ALNKHFSL--PPVSLSD 264
              +P   W+ + S+ +G+    T V+ +K  D           A N +FS   P ++ S 
Sbjct: 629  KNNPKEAWKTINSL-LGRTKENTTVNELKFDDQSLFSQEHIAEAFNDYFSNVGPKLASSM 687

Query: 263  SSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISST-AVGIDNVCSKMIALILPT 87
            ++ + +          ++  F+L  VS   V      +S+  A GID +  K++      
Sbjct: 688  ANPSKSFEHFIKPCSAQMSRFKL--VSNTKVLKLLGCLSNAKATGIDKISGKILKCAAHA 745

Query: 86   VAPILTDIFNFSFTSSNFPDSWKPA 12
            ++P LT IFN S  S+ FPD WK A
Sbjct: 746  ISPSLTYIFNNSIISNCFPDEWKMA 770


>SB_53800| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 666

 Score = 85.4 bits (202), Expect = 4e-17
 Identities = 66/256 (25%), Positives = 109/256 (42%), Gaps = 10/256 (3%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKH-KP 573
           R  K +D       +    W        I+D++ ++      + D H P R  R+   KP
Sbjct: 225 RRMKDLDESRFLSTLKTIPWDTAFLFDTIDDILGAWEQLFNGVLDNHCPWREKRVARVKP 284

Query: 572 APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLE-N 396
            PW+T ++  L+           R         Y+++RN+ +   + AK  +++   E N
Sbjct: 285 TPWITKEVLQLIQKRDALLKKARRSSLADDWDSYRSVRNKASNAIKSAKYKFYNSCFEEN 344

Query: 395 RS-PAHTWRFLKSV-GIG-KTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISS- 228
           +S P   W+ +KS+ G   KT   S  +      N    LP V    S     +L     
Sbjct: 345 KSNPKGVWKIIKSLMGTDEKTEKRSTCNLSANDFNLEKLLPSVPFDISKLEHFVLSRKDP 404

Query: 227 ---LSVPRIPI-FELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIF 60
               S+PRIPI F ++ +   ++R         A+GID   +K++ L  P +AP ++ + 
Sbjct: 405 ETVFSIPRIPIGFTINCLQTLNLRK--------AMGIDKFSAKILKLAAPIIAPSISKLM 456

Query: 59  NFSFTSSNFPDSWKPA 12
           N+S  SS FP  WK A
Sbjct: 457 NYSIESSEFPKRWKTA 472


>SB_22068| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 987

 Score = 81.8 bits (193), Expect = 5e-16
 Identities = 68/265 (25%), Positives = 111/265 (41%), Gaps = 19/265 (7%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKH-KP 573
            R  K +D       +    W        I+D++ ++      + D H P R  R+   KP
Sbjct: 460  RRMKDLDESRFLSTLKTIPWDTAFLFDTIDDILGAWEQLFNGVLDNHCPWREKRVARVKP 519

Query: 572  APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLE-N 396
             PW+T  +  L+           R         Y+++RN+ +   + AK  +++   E N
Sbjct: 520  TPWITKQVLQLIPKRDALLKKARRSSLADDWDSYRSVRNKASNAIKSAKYKFYNSCFEEN 579

Query: 395  RS-PAHTWRFLKSV-GIG-KTPVSSVKDTDLCALNKHFS---------LPPVSLSDSSKT 252
            +S P   W+ +KS+ G   KT   S  +      N HF+         LP V    S   
Sbjct: 580  KSNPKGVWKIIKSLMGTDEKTEKRSTCNLSANDFNVHFTSIADSLRNLLPSVPFDISKLE 639

Query: 251  ATLLKISS----LSVPRIPI-FELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPT 87
              +L         S+PRIPI F ++ +   ++R         A+GID   +K++ L  P 
Sbjct: 640  HFVLSRKDPETVFSIPRIPIGFTINCLQTLNLRK--------AMGIDKFSAKILKLAAPI 691

Query: 86   VAPILTDIFNFSFTSSNFPDSWKPA 12
            +AP ++ + N+S  SS FP  WK A
Sbjct: 692  IAPSISKLMNYSIESSEFPKRWKTA 716


>SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43)
          Length = 890

 Score = 81.4 bits (192), Expect = 7e-16
 Identities = 67/265 (25%), Positives = 112/265 (42%), Gaps = 19/265 (7%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKH-KP 573
           R  K +D       +    W        I+D++ ++      + D H P R  R+   KP
Sbjct: 164 RRMKDLDESRFLSTLKTIPWDTAFLFDTIDDILGAWEQLFNGVLDNHCPWREKRVARVKP 223

Query: 572 APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLE-N 396
            PW+T ++  L+           R         Y+++RN+ +   + AK  +++   E N
Sbjct: 224 TPWITKEVLQLISKRDALLKKARRSSLADDWDSYRSVRNKASNAIKSAKYKFYNSCFEEN 283

Query: 395 RS-PAHTWRFLKSV-GIG-KTPVSSVKDTDLCALNKHFS---------LPPVSLSDSSKT 252
           +S P   W+ +KS+ G   KT   S  +      N HF+         LP V    S   
Sbjct: 284 KSNPKGVWKIIKSLMGTDEKTEKRSTCNLSANDFNVHFTSIADSLRNLLPSVPFDISKLE 343

Query: 251 ATLLKISS----LSVPRIPI-FELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPT 87
             +L         S+PRIPI F ++ +   ++R         A+GID   ++++ L  P 
Sbjct: 344 HFVLSRKDPETVFSIPRIPIGFTINCLQTLNLRK--------AMGIDKFSARILKLAAPI 395

Query: 86  VAPILTDIFNFSFTSSNFPDSWKPA 12
           +AP ++ + N+S  SS FP  WK A
Sbjct: 396 IAPSISKLMNYSIESSEFPKRWKTA 420


>SB_36088| Best HMM Match : RVT_1 (HMM E-Value=9e-12)
          Length = 471

 Score = 81.0 bits (191), Expect = 9e-16
 Identities = 67/262 (25%), Positives = 111/262 (42%), Gaps = 19/262 (7%)
 Frame = -3

Query: 740 KGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKH-KPAPW 564
           K +D       +    W        I+D++ ++      + D H P R  R+   KP PW
Sbjct: 2   KDLDESRFLSTLKTIPWDTAFLFDTIDDILGAWEQLFNGVLDNHCPWREKRVARVKPTPW 61

Query: 563 LTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLE-NRS- 390
           +T ++  L+           R         Y+++RN+ +   + AK  +++   E N+S 
Sbjct: 62  ITKEVLQLIQKRDALLKKARRSSLADDWDSYRSVRNKASNAIKSAKYKFYNSCFEENKSN 121

Query: 389 PAHTWRFLKSV-GIG-KTPVSSVKDTDLCALNKHFS---------LPPVSLSDSSKTATL 243
           P   W+ +KS+ G   KT   S  +      N HF+         LP V    S     +
Sbjct: 122 PKGVWKIIKSLMGTDEKTEKRSTCNLSANDFNVHFTSIADSLRNLLPSVPFDISKLEHFV 181

Query: 242 LKISS----LSVPRIPI-FELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAP 78
           L         S+PRIPI F ++ +   ++R         A+GID   +K++ L  P +AP
Sbjct: 182 LSRKDPETVFSIPRIPIGFTINCLQTLNLRK--------AMGIDKFSAKILKLAAPIIAP 233

Query: 77  ILTDIFNFSFTSSNFPDSWKPA 12
            ++ + N+S  SS FP  WK A
Sbjct: 234 SISKLMNYSIESSEFPKRWKTA 255


>SB_34129| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=4.7)
          Length = 254

 Score = 81.0 bits (191), Expect = 9e-16
 Identities = 59/251 (23%), Positives = 111/251 (44%), Gaps = 15/251 (5%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+YK  D  +   D+ N  W  +    +I+D + ++N   + + D HAP++R R+K  P 
Sbjct: 5   RSYKNFDADSFNDDLRNVPWHIVNSMDDIDDALLTWNQLFLEVADDHAPIKRQRVKGTPI 64

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRS 390
           PW+   I   M           +  TE     Y+ LRN+ N+L + +K  Y+   +E   
Sbjct: 65  PWMNNQISESMKERDIAHRIARKLNTERHWKTYRNLRNKVNKLVKSSKSKYYCDMIEKSK 124

Query: 389 --PAHTWRFLKSVGIGKTPVSSVKD--TD----------LCALNKHFSLPPVSLSDSSKT 252
                 W+ +      K+ + S++   TD            A+N  F+     L+D   T
Sbjct: 125 GDSGKIWKAVNEACNRKSTLESIQCIITDNIQHITPSSIATAMNCFFASIGQRLADKFTT 184

Query: 251 ATLLKISSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPI 75
               + S L+  +   F+L  ++ + V      +  + A+G+D + ++++     T+AP 
Sbjct: 185 CKSNQSSVLN--QTCQFQLIELNESFVLEQLLQLKVNKAIGLDKISARLLKNSARTIAPS 242

Query: 74  LTDIFNFSFTS 42
           +T++ N S  S
Sbjct: 243 ITNMLNLSIRS 253


>SB_27268| Best HMM Match : RVT_1 (HMM E-Value=2.24208e-44)
          Length = 548

 Score = 81.0 bits (191), Expect = 9e-16
 Identities = 67/262 (25%), Positives = 111/262 (42%), Gaps = 19/262 (7%)
 Frame = -3

Query: 740 KGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKH-KPAPW 564
           K +D       +    W        I+D++ ++      + D H P R  R+   KP PW
Sbjct: 2   KDLDESRFLSTLKTIPWDTAFLFDTIDDILGAWEQLFNGVLDNHCPWREKRVARVKPTPW 61

Query: 563 LTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLE-NRS- 390
           +T ++  L+           R         Y+++RN+ +   + AK  +++   E N+S 
Sbjct: 62  ITKEVLQLIQKRDALLKKARRSSLADDWDSYRSVRNKASNAIKSAKYKFYNSCFEENKSN 121

Query: 389 PAHTWRFLKSV-GIG-KTPVSSVKDTDLCALNKHFS---------LPPVSLSDSSKTATL 243
           P   W+ +KS+ G   KT   S  +      N HF+         LP V    S     +
Sbjct: 122 PKGVWKIIKSLMGTDEKTEKRSTCNLSANDFNVHFTSIADSLRNLLPSVPFDISKLEHFV 181

Query: 242 LKISS----LSVPRIPI-FELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAP 78
           L         S+PRIPI F ++ +   ++R         A+GID   +K++ L  P +AP
Sbjct: 182 LSRKDPETVFSIPRIPIGFTINCLQTLNLRK--------AMGIDKFSAKILKLAAPIIAP 233

Query: 77  ILTDIFNFSFTSSNFPDSWKPA 12
            ++ + N+S  SS FP  WK A
Sbjct: 234 SISKLMNYSIESSEFPKRWKTA 255


>SB_47788| Best HMM Match : Cir_Bir_Yir (HMM E-Value=8.6)
          Length = 294

 Score = 80.2 bits (189), Expect = 2e-15
 Identities = 56/223 (25%), Positives = 99/223 (44%), Gaps = 8/223 (3%)
 Frame = -3

Query: 656 MVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPD-IKTLMXXXXXXXXXXXRCPTEHSL 480
           MV  FN       ++HAP+RR+++   PAPW+  D I+ L               T  S 
Sbjct: 1   MVQGFNTLFTECIERHAPLRRIKVTRPPAPWMDCDEIRELQAKRDKLMREAHTKNTVDSW 60

Query: 479 AIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALN 300
             ++++RNR   +   +KR +   +L ++ P   WR +  + +  +P     D D   LN
Sbjct: 61  VAFRSIRNRIKSVINKSKRAFITNALSSKRPKDVWRVIHRI-LNPSPKPLQADPD--KLN 117

Query: 299 KHF---SLPPVSLSDSSKTATLLKISSL---SVPRIPIFELSPVSVADVRNSFFSI-SST 141
           + F   +   +      ++  +  +++     +P  P F+L  VS  +V      + S T
Sbjct: 118 RFFVTTNERTLGTKADDRSGLIELVNNFVEDPLPSRPPFKLRCVSKQEVEQEINKLRSDT 177

Query: 140 AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           + G+D +  K + L    ++  +T I N    +SNFP  WK A
Sbjct: 178 STGVDQIPVKFVKLAKEHISGPITHINNKCILTSNFPKLWKIA 220


>SB_20258| Best HMM Match : Exo_endo_phos (HMM E-Value=7.1e-16)
          Length = 525

 Score = 79.8 bits (188), Expect = 2e-15
 Identities = 59/251 (23%), Positives = 110/251 (43%), Gaps = 15/251 (5%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
            R+YK  D  +   D+ N  W  +    +I+D + ++N   + + D HAP++R R+K  P 
Sbjct: 276  RSYKNFDADSFNDDLRNVPWHIVNSMDDIDDALLTWNQLFLEVADDHAPIKRQRVKGTPI 335

Query: 569  PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR- 393
            PW+   I   M           +  TE     Y+ LRN+ N+L + +K  Y+   +E   
Sbjct: 336  PWMNNQISESMKERDIAHRIARKLNTERHWKTYRNLRNKVNKLVKSSKSKYYCDMIEKSK 395

Query: 392  -SPAHTWRFLKSVGIGKTPVSSVK--DTD----------LCALNKHFSLPPVSLSDSSKT 252
                  W+ +      K+   S++   TD            A+N  F+     L+D   T
Sbjct: 396  GDSGKIWKAVNEACNRKSTSESIQCIITDNIQHITPSSIATAMNCFFASIGQRLADKFTT 455

Query: 251  ATLLKISSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPI 75
                + S L+  +   F+L  ++ + V      +  + A+G+D + ++++     T+AP 
Sbjct: 456  CKSNQSSVLN--QTCQFQLIELNESFVLEQLLQLKVNKAIGLDKISARLLKNSARTIAPS 513

Query: 74   LTDIFNFSFTS 42
            +T++ N S  S
Sbjct: 514  ITNMLNLSIRS 524


>SB_50373| Best HMM Match : HC2 (HMM E-Value=0.001)
          Length = 382

 Score = 77.0 bits (181), Expect = 2e-14
 Identities = 57/222 (25%), Positives = 94/222 (42%), Gaps = 16/222 (7%)
 Frame = -3

Query: 635 KVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRN 456
           K +++ D+HAP+R  R K+K + W+TPD+  L            +         ++  RN
Sbjct: 134 KGVAVLDKHAPLRSKRTKNKRSRWITPDLLRLTYKRDFLKKKAAQSNNSDDWLEFRLSRN 193

Query: 455 RCNRLCRDAKRLYFHKSLEN--RSPAHTWRFLK-------------SVGIGKTPVSSVKD 321
           + N   + AK+ YF   LE     P  TW+ +              SV  G   ++S  +
Sbjct: 194 KANNAIKAAKKEYFSAGLERAKNDPRQTWKLINEAQGRQSTTSRIMSVKTGTGSLNSAAE 253

Query: 320 TDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISS- 144
               A N+HFS     L+       +  +S +  P    F  + +    V      + + 
Sbjct: 254 I-ATAFNEHFSTIGAQLAHEIPITDIDPVSFMP-PVDSHFSFNKIKTDQVTKLLQKLDAG 311

Query: 143 TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
            A G+D + SK++ L    ++P LT+IFN S +   FP  WK
Sbjct: 312 KATGLDKIPSKLLKLASKIISPSLTEIFNQSLSLGIFPGDWK 353


>SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1182

 Score = 76.2 bits (179), Expect = 3e-14
 Identities = 62/259 (23%), Positives = 113/259 (43%), Gaps = 15/259 (5%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+YK +D  +   D+ N  W  +    +I+D + ++N   + + D HAP++R R+K  P 
Sbjct: 150 RSYKNLDADSFNDDLRNVPWHIVNSMDDIDDALLTWNQLFLEVADDHAPIKRQRVKGTPI 209

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR- 393
           PW+   I   M                H +A    LRN+ N+L + +K  Y+   +E   
Sbjct: 210 PWMNNQISESMKER----------DIAHRIA---NLRNKVNKLVKSSKSKYYCDMIEKSK 256

Query: 392 -SPAHTWRFLKSVGIGKTPVSSVK--DTD----------LCALNKHFSLPPVSLSDSSKT 252
                 W+ +      K+   S++   TD            A+N  F+     L+D   T
Sbjct: 257 GDSGKIWKAVNEACNRKSTSESIQCIITDNIQHITPSSIATAMNCFFASIGQRLADKFTT 316

Query: 251 ATLLKISSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPI 75
               + S L+  +   F+L  ++ + V      +  + A+G+D + ++++     T+AP 
Sbjct: 317 CKSNQSSVLN--QTCQFQLIELNESFVLEQLLQLKVNKAIGLDKISARLLKNSALTIAPS 374

Query: 74  LTDIFNFSFTSSNFPDSWK 18
           +T++ N S  S  FP  WK
Sbjct: 375 ITNMLNLSIRSGKFPKLWK 393


>SB_35013| Best HMM Match : Exo_endo_phos (HMM E-Value=0.027)
          Length = 381

 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 43/139 (30%), Positives = 76/139 (54%), Gaps = 3/139 (2%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+ K +D  A  +D++   WS +    +++D V+ +N   +S+ D HAP+ R R+K +  
Sbjct: 203 RDCKKLDEEAFLKDLDEAPWSVLDTFDDLDDAVDYWNRTFLSIADIHAPLIRKRVKKQSQ 262

Query: 569 P-WLTPDIKTLMXXXXXXXXXXXRCPTE-HSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
           P W+TP++   +           +C ++  +   +K+ RN   +  R+AKR +F+KS E 
Sbjct: 263 PQWMTPELYAAIRDRDRLLERARKCNSDSDAWETFKSARNNVFQSIREAKRNHFNKSFEQ 322

Query: 395 RSPA-HTWRFLKSVGIGKT 342
            S A   WR+LK + IG+T
Sbjct: 323 SSTAKEFWRYLK-IAIGQT 340


>SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 917

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 69/238 (28%), Positives = 106/238 (44%), Gaps = 22/238 (9%)
 Frame = -3

Query: 659 DMVNSFNYKVISLF----DQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPT 492
           D +NS     I LF    D+HAPV+  R K    PWLT +IK L+               
Sbjct: 190 DKINSSGVIHIDLFLNVLDRHAPVQSKRKKAFNVPWLTREIKDLINNRDKLKRKAMVSKL 249

Query: 491 EHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR--SPAHTWRFLKSVGIGK----TPVSS 330
            +    +KA RN+ N   R AK  Y+   + N+  +P   W+ + S+ +G+    T V+ 
Sbjct: 250 RNDWDDFKASRNKVNIALRQAKSNYYRNKIANQKNNPKEAWKTINSL-LGRTKENTTVNE 308

Query: 329 VKDTDLC---------ALNKHFSL--PPVSLSDSSKTATLLKISSLSVPRIPIFELSPVS 183
           +K  D           A N +FS   P ++ S ++ + +          ++  F+L  VS
Sbjct: 309 LKFDDQSLFSQEHIAEAFNDYFSNVGPKLASSMANPSKSFEHFIKPCSAQMSRFKL--VS 366

Query: 182 VADVRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
              V      +S+  A GID +  K++      ++P LT IFN S  S+ FPD WK A
Sbjct: 367 NTKVLKLLGCLSNAKATGIDKISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMA 424


>SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 893

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 65/258 (25%), Positives = 116/258 (44%), Gaps = 27/258 (10%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
            R+ K +D  A  +D++   WS +    +++D V+ +N   +S+ D HAP+ R R+K +  
Sbjct: 351  RDCKKLDEEAFLKDLDEAPWSVLDTFDDLDDAVDYWNLTFLSIADIHAPLIRKRVKKQSQ 410

Query: 569  P-WLTPDIKTLMXXXXXXXXXXXRCPTE-HSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
            P W+TP++   +           +C ++  +   +K+ RN   +  R+AKR +F+KS E 
Sbjct: 411  PQWMTPELYAAIRDRDRLLERARKCNSDSDAWETFKSTRNNGFQSIREAKRNHFNKSFEQ 470

Query: 395  RSPAHT-WRFLK-SVG-------------IGKTPVSSVKDTDLCALNKHFSLPPVSLSDS 261
             S A   WR LK ++G               KTP  +       A N+ F     +  +S
Sbjct: 471  SSTAKDFWRHLKIAIGQTIKPSPSQLRGNASKTPTITDPREIANAFNEFFVSVAATYRNS 530

Query: 260  S------KTATLLKISSLSVPRIPI---FELSPVSVADVRNSFFSISS-TAVGIDNVCSK 111
            +       T+   K+      +IP    FE+  V    V+     + +  A G+D + ++
Sbjct: 531  NVNMRTLSTSDFEKLKGFVDSKIPSGTKFEIPKVMQEFVQGYLLQLQTCKATGLDGISAR 590

Query: 110  MIALILPTVAPILTDIFN 57
            ++      +AP LT I N
Sbjct: 591  LLRAAAQAIAPSLTKIIN 608


>SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13)
          Length = 675

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 65/258 (25%), Positives = 116/258 (44%), Gaps = 27/258 (10%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+ K +D  A  +D++   WS +    +++D V+ +N   +S+ D HAP+ R R+K +  
Sbjct: 133 RDCKKLDEEAFLKDLDEAPWSVLDTFDDLDDAVDYWNLTFLSIADIHAPLIRKRVKKQSQ 192

Query: 569 P-WLTPDIKTLMXXXXXXXXXXXRCPTE-HSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
           P W+TP++   +           +C ++  +   +K+ RN   +  R+AKR +F+KS E 
Sbjct: 193 PQWMTPELYAAIRDRDRLLERARKCNSDSDAWETFKSTRNNGFQSIREAKRNHFNKSFEQ 252

Query: 395 RSPAHT-WRFLK-SVG-------------IGKTPVSSVKDTDLCALNKHFSLPPVSLSDS 261
            S A   WR LK ++G               KTP  +       A N+ F     +  +S
Sbjct: 253 SSTAKDFWRHLKIAIGQTIKPSPSQLRGNASKTPTITDPREIANAFNEFFVSVAATYRNS 312

Query: 260 S------KTATLLKISSLSVPRIPI---FELSPVSVADVRNSFFSISS-TAVGIDNVCSK 111
           +       T+   K+      +IP    FE+  V    V+     + +  A G+D + ++
Sbjct: 313 NVNMRTLSTSDFEKLKGFVDSKIPSGTKFEIPKVMQEFVQGYLLQLQTCKATGLDGISAR 372

Query: 110 MIALILPTVAPILTDIFN 57
           ++      +AP LT I N
Sbjct: 373 LLRAAAQAIAPSLTKIIN 390


>SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43)
          Length = 1029

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 66/270 (24%), Positives = 128/270 (47%), Gaps = 24/270 (8%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHH----NINDMVNSFNYKVISLFDQHAPVR---RV 591
            R++  +D  AL  D+ + +W  +L  +    N+ND+  SF   + ++ D+H P+R   R 
Sbjct: 433  RDFSKLDKEALLSDIQSINWIDVLPSNDGSKNVNDIFQSFFSNISAIIDKHVPLRKRTRK 492

Query: 590  RIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFH 411
             IK    PW+T  I T +              +E+ L+ YK  RN+ ++L R +K+ Y+ 
Sbjct: 493  EIKSLSKPWITKGIITSIKLKDKFYKKYLVSRSEYYLSKYKCYRNKISQLIRTSKQNYYQ 552

Query: 410  K--SLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLP-PVSLSDSSKTATL- 243
               +  +++  + W  +K + I   P  S + + L   NK    P  ++++ ++  AT+ 
Sbjct: 553  NYFATNSKNIKNIWSGIKEL-ITTKPTCSNQPSKLIINNKTAKDPKAIAIAFNNFFATIG 611

Query: 242  ----LKI--------SSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIA 102
                 KI        S L  P +  F LSPV+ +++ +    ++ S A G  ++   ++ 
Sbjct: 612  SQLASKIPHVDRSPESFLGPPLVNSFVLSPVTASEIEDIISGLNPSKASGPYSIPVCLLK 671

Query: 101  LILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
             +   ++  L  ++N SF++   PD +K A
Sbjct: 672  FLKSYLSVPLEILYNHSFSNGCVPDQFKIA 701


>SB_798| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 845

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 67/265 (25%), Positives = 108/265 (40%), Gaps = 19/265 (7%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKH-KP 573
            R  K +D       +    W        I+D++ ++      + D H P R  R+   KP
Sbjct: 397  RRMKDLDESRFLSTLKTIPWDTAFLFDTIDDILGAWEQLFNGVLDNHCPWREKRVARVKP 456

Query: 572  APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLE-N 396
             PW+T  +  L+           R            +RN+ +   + AK  +++   E N
Sbjct: 457  TPWITKQVLQLIPKRDALLKKARRSSLADDWD--SLVRNKASNAIKSAKYKFYNSCFEEN 514

Query: 395  RS-PAHTWRFLKSV-GIG-KTPVSSVKDTDLCALNKHFS---------LPPVSLSDSSKT 252
            +S P   W+ +KS+ G   KT   S  +      N HF+         LP V    S   
Sbjct: 515  KSNPKGVWKIIKSLMGTDEKTEKRSTCNLSANDFNVHFTSIADSLRNLLPSVPFDISKLE 574

Query: 251  ATLLKISS----LSVPRIPI-FELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPT 87
              +L         S+PRIPI F ++ +   ++R         A+GID   +K++ L  P 
Sbjct: 575  HFVLSRKDPETVFSIPRIPIGFTINCLQTLNLRK--------AMGIDKFSAKILKLAAPI 626

Query: 86   VAPILTDIFNFSFTSSNFPDSWKPA 12
            +AP ++ + N+S  SS FP  WK A
Sbjct: 627  IAPSISKLMNYSIESSEFPKRWKTA 651


>SB_59377| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7)
          Length = 839

 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 61/252 (24%), Positives = 104/252 (41%), Gaps = 5/252 (1%)
 Frame = -3

Query: 752  LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
            +R+ +  D  A   D+     S +    +    +   N  +    D+HAP++R ++   P
Sbjct: 416  IRDERNFDEHAFTNDIEQLPLSIVYSTSDPEMQLEMLNTLLRECIDRHAPLKRTKVTRPP 475

Query: 572  APWLTP-DIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
            APWL   DI+ L            +  ++     ++  RN+   +   AKR  ++K+L +
Sbjct: 476  APWLKELDIQNLQQDCRNMRTEARKDKSDSIWNSFREKRNQLKAMIGKAKRNSYYKALSS 535

Query: 395  RSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKT-ATLLK--ISSL 225
                  WR +  + +   P     D D   LN HF+     ++ ++ T A  +   I SL
Sbjct: 536  VKAKEVWRVIHRI-LHPNPQPLRFDPD--ELNTHFASTAERVTGATPTSANNISDLIQSL 592

Query: 224  SVPRIPIFELSPVSVADVRNSFFSI-SSTAVGIDNVCSKMIALILPTVAPILTDIFNFSF 48
                +  F L PVS   V ++   + S  + G D +  K I      +A  LT I N   
Sbjct: 593  PEDLVWAFTLKPVSCLQVLSALKKLRSDCSCGPDRIPVKFIKHAADHLASPLTHILNTCI 652

Query: 47   TSSNFPDSWKPA 12
            +   FP +WK A
Sbjct: 653  SQEYFPSAWKVA 664


>SB_35561| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00092)
          Length = 813

 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 61/252 (24%), Positives = 104/252 (41%), Gaps = 5/252 (1%)
 Frame = -3

Query: 752  LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
            +R+ +  D  A   D+     S +    +    +   N  +    D+HAP++R ++   P
Sbjct: 390  IRDERNFDEHAFTNDIEQLPLSIVYSTSDPEMQLEMLNTLLRECIDRHAPLKRTKVTRPP 449

Query: 572  APWLTP-DIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
            APWL   DI+ L            +  ++     ++  RN+   +   AKR  ++K+L +
Sbjct: 450  APWLKELDIQNLQQDCRNMRTEARKDKSDSIWNSFREKRNQLKAMIGKAKRNSYYKALSS 509

Query: 395  RSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKT-ATLLK--ISSL 225
                  WR +  + +   P     D D   LN HF+     ++ ++ T A  +   I SL
Sbjct: 510  VKAKEVWRVIHRI-LHPNPQPLRFDPD--ELNTHFASTAERVTGATPTSANNISDLIQSL 566

Query: 224  SVPRIPIFELSPVSVADVRNSFFSI-SSTAVGIDNVCSKMIALILPTVAPILTDIFNFSF 48
                +  F L PVS   V ++   + S  + G D +  K I      +A  LT I N   
Sbjct: 567  PEDLVWAFTLKPVSCLQVLSALKKLRSDCSCGPDRIPVKFIKHAADHLASPLTHILNTCI 626

Query: 47   TSSNFPDSWKPA 12
            +   FP +WK A
Sbjct: 627  SQEYFPSAWKVA 638


>SB_25245| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 306

 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 47/166 (28%), Positives = 83/166 (50%), Gaps = 3/166 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+ K +D  A  +D++   WS +    +++D V+ +N   +S+ D HAP+ R R+K +  
Sbjct: 115 RDCKKLDEEAFLKDLDEAPWSVLDTFDDLDDAVDYWNLTFLSIADIHAPLIRKRVKKQSQ 174

Query: 569 P-WLTPDIKTLMXXXXXXXXXXXRCPTE-HSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
           P W+TP++   +           +C ++  +   +K+ RN   +  R+AKR +F+KS E 
Sbjct: 175 PQWMTPELYAAIRDRDRLLERARKCNSDSDAWETFKSARNNVFQSIREAKRNHFNKSFEQ 234

Query: 395 RSPA-HTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDS 261
            S A   WR LK+  IG+T   S       A N    + P  + ++
Sbjct: 235 SSTAKEFWRHLKN-AIGQTSKPSPSQLRANASNTPTIIDPREIDNA 279


>SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044)
          Length = 1693

 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 66/270 (24%), Positives = 127/270 (47%), Gaps = 24/270 (8%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHH----NINDMVNSFNYKVISLFDQHAPVR---RV 591
            R++  +D  AL  D+ + +W  +L  +    N+ND+  SF   + ++ D+H P+R   R 
Sbjct: 1311 RDFSKLDKEALLSDIQSINWIDVLPSNDGSKNVNDIFQSFFSNISAIIDKHVPLRKRTRK 1370

Query: 590  RIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFH 411
             IK    PW+T  I T +              +E+ L+ YK  RN+ ++L R +K+ Y+ 
Sbjct: 1371 EIKSLSKPWITKGIITSIKLKDKFYKKYLVSRSEYYLSKYKCYRNKISQLIRTSKQNYYQ 1430

Query: 410  K--SLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLP-PVSLSDSSKTATL- 243
               +  +++  + W  +K + I   P  S + + L   NK    P  ++++ ++  AT+ 
Sbjct: 1431 NYFATNSKNIKNIWSGIKEL-ITTKPTCSNQPSKLIINNKTVKNPKAIAIAFNNFFATIG 1489

Query: 242  ----LKI--------SSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIA 102
                 KI        S L  P +  F LSPV+  ++ +    ++ S A G  ++   ++ 
Sbjct: 1490 SQLASKIPHVDRSPESFLGPPLVNSFVLSPVTAFEIEDIISGLNPSKASGPYSIPVCLLK 1549

Query: 101  LILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
             +   ++  L  ++N SF++   PD +K A
Sbjct: 1550 FLKSYLSVPLEILYNHSFSNGCVPDQFKIA 1579


>SB_48325| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 872

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 66/270 (24%), Positives = 127/270 (47%), Gaps = 24/270 (8%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHH----NINDMVNSFNYKVISLFDQHAPVR---RV 591
            R++  +D  AL  D+ + +W  +L  +    N+ND+  SF   + ++ D+H P+R   R 
Sbjct: 382  RDFSKLDKEALLSDIQSINWIDVLPSNDGSKNVNDIFQSFFSNISAIIDKHVPLRKRTRK 441

Query: 590  RIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFH 411
             IK    PW+T  I T +              +E+ L+ YK  RN+ ++L R +K+ Y+ 
Sbjct: 442  EIKSLSKPWITKGIITSIKLKDKFYKKYLVSRSEYYLSKYKCYRNKISQLIRTSKQNYYQ 501

Query: 410  K--SLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLP-PVSLSDSSKTATL- 243
               +  +++  + W  +K + I   P  S + + L   NK    P  ++++ ++  AT+ 
Sbjct: 502  NYFATNSKNIKNIWSGIKEL-ITTKPTCSNQPSKLIINNKTVKDPKAIAIAFNNFFATIG 560

Query: 242  ----LKI--------SSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIA 102
                 KI        S L  P +  F LSPV+  ++ +    ++ S A G  ++   ++ 
Sbjct: 561  SQLASKIPHVDRSPESFLGPPLVNSFVLSPVTAFEIEDIISGLNPSKASGPYSIPVCLLK 620

Query: 101  LILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
             +   ++  L  ++N SF++   PD +K A
Sbjct: 621  FLKSYLSVPLEILYNHSFSNGCVPDQFKIA 650


>SB_28802| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00055)
          Length = 411

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 43/139 (30%), Positives = 76/139 (54%), Gaps = 3/139 (2%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+ K +D  AL +D++   WS +    +++D V+ +N   +S+ + HAP+ R R+K +  
Sbjct: 233 RDCKKLDEEALLKDLDEAPWSVLDTFDDLDDAVDYWNLTFLSIANIHAPLIRKRVKKQSQ 292

Query: 569 P-WLTPDIKTLMXXXXXXXXXXXRCPTE-HSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
           P W+TP++   +           +C ++  +   +K+ RN   +  R+AKR +F+KS E 
Sbjct: 293 PQWMTPELYPAIRDRDRLLERARKCNSDSDAWETFKSARNNVFQSIREAKRNHFNKSFEQ 352

Query: 395 RSPA-HTWRFLKSVGIGKT 342
            S A   WR LKS  +G+T
Sbjct: 353 SSTAKEFWRHLKS-AVGQT 370


>SB_10116| Best HMM Match : RVT_1 (HMM E-Value=2.5e-33)
          Length = 759

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 64/269 (23%), Positives = 121/269 (44%), Gaps = 23/269 (8%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHH----NINDMVNSFNYKVISLFDQHAPVR---RV 591
            R++  +D  AL  D+ + +W  +L  +    N+ND+  SF   + ++ D+H P+R   R 
Sbjct: 258  RDFSKLDKEALLSDIQSINWIDVLPSNDGSKNVNDIFQSFFSNISAIIDKHVPLRKRTRK 317

Query: 590  RIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFH 411
             IK    PW+T  I T +              +E+ L+ YK  RN+ +++ R +K+ Y+ 
Sbjct: 318  EIKSLSKPWITKGIITSIKLKDKFYKKYLVSRSEYYLSKYKCYRNKISQVIRTSKQNYYQ 377

Query: 410  K--SLENRSPAHTWRFLKSVGIGKTPVSS-----------VKDTDLCAL--NKHFSLPPV 276
               +  +++  + W  +K +   K   S+           VKD    A+  N  F+    
Sbjct: 378  NYFATNSKNIKNIWSGIKELITTKPTCSNQPSKLIINNKPVKDPKAIAIAFNNFFATIGS 437

Query: 275  SLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIAL 99
             L+           S L  P +  F LSPV+  ++ +    ++ S A G  ++   ++ L
Sbjct: 438  QLASKLPHVDRSPESFLGPPLVNSFVLSPVTAFEIEDIISGLNPSKASGPYSIPVCLLKL 497

Query: 98   ILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
            +   ++  L  ++N SF++   PD +K A
Sbjct: 498  LKSYLSVPLEILYNHSFSNGCVPDQFKIA 526


>SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11)
          Length = 809

 Score = 71.3 bits (167), Expect = 8e-13
 Identities = 42/139 (30%), Positives = 75/139 (53%), Gaps = 3/139 (2%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+ K +D  A   D++   WS +   ++++D V+ +N   +S+ D HAP+ R R+K +  
Sbjct: 79  RDCKKLDEEAFPEDLDEAPWSVLDTFNDLDDAVDYWNVTFLSIADIHAPLIRKRVKKQSQ 138

Query: 569 P-WLTPDIKTLMXXXXXXXXXXXRCPTE-HSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
           P W+TP++   +           +C ++  +   +K+ RN   +  ++AKR +F+KS E 
Sbjct: 139 PQWMTPELYAAIRDRDRLLEIARKCNSDSDAWETFKSARNNVFQSIQEAKRNHFNKSFEQ 198

Query: 395 RSPA-HTWRFLKSVGIGKT 342
            S A   WR LK + IG+T
Sbjct: 199 SSTAKEFWRHLK-IAIGQT 216


>SB_42532| Best HMM Match : Exo_endo_phos (HMM E-Value=7.2e-16)
          Length = 399

 Score = 71.3 bits (167), Expect = 8e-13
 Identities = 33/117 (28%), Positives = 56/117 (47%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+YK  D  +   D+ N  W  +    +I+D + ++N   + + D HAP++R R+K  P 
Sbjct: 276 RSYKNFDADSFNDDLRNVPWHIVNSMDDIDDALLTWNQLFLEVADDHAPIKRQRVKGTPI 335

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLE 399
           PW+   I   M           +  TE     Y+ LRN+ N+L + +K  Y+   +E
Sbjct: 336 PWMNNQISESMKERDIAHRIARKLNTERHWKTYRNLRNKVNKLVKSSKSKYYCDMIE 392


>SB_63| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 680

 Score = 70.9 bits (166), Expect = 1e-12
 Identities = 62/224 (27%), Positives = 101/224 (45%), Gaps = 18/224 (8%)
 Frame = -3

Query: 629 ISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRC 450
           +++ D+HAPV+  R K    PWLT +IK L+                +    +KA RN+ 
Sbjct: 10  LNVLDRHAPVQSKRKKAFNVPWLTREIKDLINNRDKLKRKAMVSKLRNDWDDFKASRNKV 69

Query: 449 NRLCRDAKRLYFHKSLENR--SPAHTWRFLKSVGIGK----TPVSSVKDTDLC------- 309
           N   R AK  Y+   + N+  +P   W+ + S+ +G+    T  + +K  D         
Sbjct: 70  NIALRQAKSNYYRNKIANQKNNPKEAWKTINSL-LGRTKENTTANELKFDDQSLFSQEHI 128

Query: 308 --ALNKHFSL--PPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISST 141
             A N +FS   P ++ S ++ + +          ++  F+L  VS   V      +S+ 
Sbjct: 129 AEAFNDYFSNVGPKLASSMANPSKSFEHFIKPCSAQMSRFKL--VSNTKVLKLLGCLSNA 186

Query: 140 -AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
            A GID +  K++      ++P LT IFN S  S+ FPD WK A
Sbjct: 187 KATGIDKISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMA 230


>SB_21614| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-41)
          Length = 1047

 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 65/270 (24%), Positives = 127/270 (47%), Gaps = 24/270 (8%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHH----NINDMVNSFNYKVISLFDQHAPVR---RV 591
            R++  +D  AL  D+ + +W  +L  +    N+ND+  SF   + ++ D+H P+R   R 
Sbjct: 532  RDFSKLDKEALLSDIQSFNWIDVLPSNDGSKNVNDIFQSFFSNISAIIDKHVPLRKRTRK 591

Query: 590  RIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFH 411
             IK    PW+T  I T +              +E+ L+ YK  RN+ ++L R +K+ ++ 
Sbjct: 592  EIKSLSKPWITKGIITSIKLKDKFYKKYLVSRSEYYLSKYKCYRNKISQLIRTSKQNFYQ 651

Query: 410  K--SLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLP-PVSLSDSSKTATL- 243
               +  +++  + W  +K + I   P  S + + L   NK    P  ++++ ++  AT+ 
Sbjct: 652  NYFATNSKNIKNIWSGIKEL-ITTKPTCSNQPSKLIINNKPVKDPKAIAIAFNNFFATIG 710

Query: 242  ----LKI--------SSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIA 102
                 KI        S L  P +  F LSPV+  ++ +    ++ S A G  ++   ++ 
Sbjct: 711  SQLASKIPHVDRSPESFLGPPLVNSFVLSPVTAFEIEDIISGLNPSKASGPYSIPVCLLK 770

Query: 101  LILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
             +   ++  L  ++N SF++   PD +K A
Sbjct: 771  FLKSYLSVPLEILYNHSFSNGCVPDQFKIA 800


>SB_3348| Best HMM Match : Borrelia_orfA (HMM E-Value=0.71)
          Length = 500

 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 65/270 (24%), Positives = 126/270 (46%), Gaps = 24/270 (8%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHH----NINDMVNSFNYKVISLFDQHAPVR---RV 591
           R++  +D  AL  D+ + +W  +L  +    N+ND+  SF   + ++ D+H P+R   R 
Sbjct: 84  RDFSKLDKEALLSDIQSINWIDVLPSNDGSKNVNDIFQSFFSNISAIIDKHVPLRKRTRK 143

Query: 590 RIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFH 411
            IK    PW+T  I   +              +E+ L+ YK  RN+ ++L R +K+ Y+ 
Sbjct: 144 EIKSLSKPWITKGIIISIKLKDKFYKKYLVSRSEYYLSKYKCYRNKISQLIRTSKQNYYQ 203

Query: 410 K--SLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLP-PVSLSDSSKTATL- 243
              +  +++  + W  +K + I   P  S + + L   NK    P  ++++ ++  AT+ 
Sbjct: 204 NYFATNSKNIKNIWSGIKEL-ITTKPTCSNQPSKLIINNKTVKDPKAIAIAFNNFFATIG 262

Query: 242 ----LKI--------SSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIA 102
                KI        S L  P +  F LSPV+  ++ +    ++ S A G  ++   ++ 
Sbjct: 263 SQLASKIPHVDRSPESFLGPPLVNSFVLSPVTAFEIEDIISGLNPSKASGPYSIPVCLLK 322

Query: 101 LILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
            +   ++  L  ++N SF++   PD +K A
Sbjct: 323 FLKSYLSVPLEILYNHSFSNGCVPDQFKIA 352


>SB_10251| Best HMM Match : RVT_1 (HMM E-Value=0.0022)
          Length = 717

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 39/139 (28%), Positives = 66/139 (47%), Gaps = 2/139 (1%)
 Frame = -3

Query: 752 LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           +RN+K  D     +D+    W  I+  H+ N+M   +    +++ D+HAPV+  R K   
Sbjct: 316 IRNFKHFDQQKFVKDLLTQSWEQIVLCHDTNEMWAHWKDLFLNVLDRHAPVQSKRKKAFN 375

Query: 572 APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR 393
            PWLT +IK L+                +    +KA RN+ N   R AK  Y+   + N+
Sbjct: 376 VPWLTREIKDLINNRDKLKRKAMVSKLRNDWDDFKASRNKVNIALRQAKSNYYRNKIANQ 435

Query: 392 --SPAHTWRFLKSVGIGKT 342
             +P   W+ + S+ +G+T
Sbjct: 436 KNNPKEAWKTINSL-LGRT 453


>SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12)
          Length = 1799

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 64/266 (24%), Positives = 106/266 (39%), Gaps = 20/266 (7%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHHN-----INDMVNSFNYKVISLFDQHAPVRRVRI 585
            RN+   D      D+   DW+ +L  +      ++D+ + F    + +   HAPV + R+
Sbjct: 1098 RNHANYDSRKFCEDLKGVDWNSVLTPNGQAVTGVDDLWSGFKSAFMCIAGSHAPVIQKRV 1157

Query: 584  KHKP-APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK 408
            +     PWL  +IK++M           +       A ++  RNR     + AK  Y  K
Sbjct: 1158 RGVDNCPWLNKEIKSIMRQRDYFHSKAKKSNLTVDWASHRCYRNRATNSIKKAKATYNRK 1217

Query: 407  SLENRSPAHT--WRFLKSV--GIGKT--PVSSVKDT-------DLCALNKHFSLPPVSLS 267
             +E     H   W+ LK +  G  KT  P  SV+ T        + + N  F      L 
Sbjct: 1218 LIERNGNDHKTFWKTLKKILPGEKKTVSPNISVQGTLSADKKLIVDSFNSFFRGTAARLC 1277

Query: 266  DSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISS-TAVGIDNVCSKMIALILP 90
            +S +++       +       F+   VS   +      +    AVG+DN+ ++++    P
Sbjct: 1278 ESLRSSCGAAAGLVPPSPTTSFKFQDVSEELLCAELRRLKEGKAVGLDNIPARLLIDSAP 1337

Query: 89   TVAPILTDIFNFSFTSSNFPDSWKPA 12
             VA  LT I N+S      P  WK A
Sbjct: 1338 IVAKPLTSILNYSMRHGEVPRDWKTA 1363


>SB_3024| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 806

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 55/208 (26%), Positives = 91/208 (43%), Gaps = 6/208 (2%)
 Frame = -3

Query: 617  DQHAPVRRVRIKHKPAPWLTP-DIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRL 441
            D+HAP++  ++   PAPWL   DI+ L            +  ++     ++  RN+   +
Sbjct: 574  DRHAPLKPTKMTRPPAPWLKELDIQNLQQDCRNMRTEARKDKSDSIWNSFREKRNQLKAM 633

Query: 440  CRDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDS 261
               AKR +++K+L +      WR +  + +   P     D D   LN HF      ++ +
Sbjct: 634  IGKAKRNFYYKTLSSVKAKEVWRVIHRI-LHPNPQPLRFDPD--ELNTHFGSTAERVTGA 690

Query: 260  SKTATLLKISSL--SVPRIPI--FELSPVSVADVRNSFFSI-SSTAVGIDNVCSKMIALI 96
            + T+    IS L  S+P  P+  F L  VS   V ++   + S  + G D +  K I   
Sbjct: 691  TPTSA-NNISDLIQSLPEDPVWAFTLKSVSCLQVLSALKKLRSDCSCGPDGIPEKFIKHA 749

Query: 95   LPTVAPILTDIFNFSFTSSNFPDSWKPA 12
               +A  LT I N   +   FP +WK A
Sbjct: 750  ADYLASPLTHILNTCISQEYFPSAWKVA 777


>SB_39386| Best HMM Match : RVT_1 (HMM E-Value=7.1e-28)
          Length = 1239

 Score = 66.1 bits (154), Expect = 3e-11
 Identities = 60/253 (23%), Positives = 104/253 (41%), Gaps = 6/253 (2%)
 Frame = -3

Query: 752 LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           +R+ +  D  A   D+     S +    +    +   N  +    D+HAP++R ++   P
Sbjct: 183 IRDERNFDEHAFTNDIEQLPLSIVYSTSDPEMQLEMLNTLLRECIDRHAPLKRTKVTRPP 242

Query: 572 APWLTP-DIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
           +PWL   DI+ L            +  ++     ++  RN+   +   AKR +++K+L  
Sbjct: 243 SPWLKELDIQKLQQDCRNMRTEARKDKSDSIWNSFREKRNQLKAMIGKAKRNFYYKAL-- 300

Query: 395 RSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSL--S 222
              + + R ++       P  S    D   LN HF+     ++ ++ T+    IS L  S
Sbjct: 301 ---SQSQRCVEGDSPDTPPKPSASRFDPDELNTHFASTAERVTGATPTSA-NNISDLIQS 356

Query: 221 VPRIPI--FELSPVSVADVRNSFFSI-SSTAVGIDNVCSKMIALILPTVAPILTDIFNFS 51
           +P  P+  F L PVS   V  +   + S  + G D +    I      +A  LT I N  
Sbjct: 357 LPEDPVWAFTLKPVSCLQVLAALKKLRSDCSCGPDGIPVTFIKHAADHLASPLTHILNTC 416

Query: 50  FTSSNFPDSWKPA 12
                FP +WK A
Sbjct: 417 ILQEYFPSAWKVA 429


>SB_20189| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 514

 Score = 65.3 bits (152), Expect = 5e-11
 Identities = 56/247 (22%), Positives = 104/247 (42%), Gaps = 3/247 (1%)
 Frame = -3

Query: 743 YKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAP- 567
           +K  D    +  +++  WS +    + ND    FN   + + D  APV   R+     P 
Sbjct: 54  FKDFDAEGFQEQLDHCPWSVLDMCDDPNDAAEFFNKTFLDVADIFAPVSTKRVGRPQQPQ 113

Query: 566 WLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLE-NRS 390
           W++P I   +               +   + YK  RN   +L R AK  +F ++LE + S
Sbjct: 114 WMSPGIYEAIKHRDALLKKACASNYQADWSAYKQQRNATFQLIRKAKGSFFQEALETSMS 173

Query: 389 PAHTWRFLKSVGIGKTPVSSVKDTDLCAL-NKHFSLPPVSLSDSSKTATLLKISSLSVPR 213
                +  +++    T +++  +   C + +K+ + PP + +   +  T +  +      
Sbjct: 174 SISKVKVGENISQNPTEIANAFNEFFCNVASKYRATPPGTSTCFERLKTFVGQTLKLEEC 233

Query: 212 IPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNF 33
             I E++P  +    ++   IS  A G+D + +K++ L  P +   L  I N S   S F
Sbjct: 234 FSIPEMTPDLIGRYLSTI-KISK-ATGLDGISAKLLKLAGPAIDMPLCKIINLSIKQSIF 291

Query: 32  PDSWKPA 12
           P  WK A
Sbjct: 292 PTIWKQA 298


>SB_33083| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 413

 Score = 64.9 bits (151), Expect = 7e-11
 Identities = 58/224 (25%), Positives = 103/224 (45%), Gaps = 12/224 (5%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHH----NINDMVNSFNYKVISLFDQHAPVR---RV 591
           R++  +D  AL  D  + +W  +L  +    N+ND+  SF   + ++ D+H P+R   R 
Sbjct: 185 RDFSKLDKEALLSDFQSINWIDVLPSNDGSKNVNDIFQSFFSNISAIIDKHVPLRKRTRK 244

Query: 590 RIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFH 411
            IK    PW+T  I T +              +E+  + YK  RN+ + L R +K+ Y+ 
Sbjct: 245 EIKSLSKPWITKGIITSIKLKDKFYKKYLVSRSEYYHSKYKCYRNKISHLIRTSKQNYYR 304

Query: 410 K--SLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLP-PVSLSDSSKTATLL 240
              +  +++  + W  +K + I   P  S + + L   NK    P  ++++ ++  AT  
Sbjct: 305 NYFATNSKNIKNIWSGIKEL-ITTKPTCSNQPSKLIINNKTVKDPKAIAIAFNNFFAT-- 361

Query: 239 KISSLSVPRIPIFELSPVSV--ADVRNSFFSISSTAVGIDNVCS 114
            I S    +IP  + SP S     + NSF     TA  I+++ S
Sbjct: 362 -IGSQLASKIPHVDRSPESFLGPPLVNSFVLSPVTAFEIEDIIS 404


>SB_45005| Best HMM Match : RVT_1 (HMM E-Value=6.6e-32)
          Length = 871

 Score = 64.5 bits (150), Expect = 9e-11
 Identities = 37/146 (25%), Positives = 71/146 (48%), Gaps = 2/146 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R  K  +  A R D+ + +W+ +  +++ N M N++    +   ++HAP    R++   +
Sbjct: 298 RKLKNFNYDAFRADIASLNWNFLNSYNDPNVMWNNWKEMFLHFVEKHAPFCAKRVRLSKS 357

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSL-ENR 393
           PW+  D+K LM           R    +   I+K  RN  N   + AK++Y+  +  EN 
Sbjct: 358 PWINSDLKKLMHQRVVFKIKAIRSKDVNDWKIFKKYRNFVNCQIKIAKQIYYDNAFRENE 417

Query: 392 -SPAHTWRFLKSVGIGKTPVSSVKDT 318
            +  +TW+ +  +   KT  S++K+T
Sbjct: 418 GNIRNTWKVINELTSRKTNNSTIKET 443


>SB_48818| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00029)
          Length = 318

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 30/103 (29%), Positives = 48/103 (46%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R YK  D  +   D+ N  W  +    +I+D + ++N   + + D HAP++R R+K  P 
Sbjct: 216 RPYKNFDADSFNDDLRNVPWHIVNSMDDIDDALLTWNQLFLEVADDHAPIKRQRVKGTPI 275

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRL 441
           PW+   I   M           +  TE     Y+ LRN+ N+L
Sbjct: 276 PWMNNQISESMKERDIAHRIARKLNTERHWKTYRNLRNKVNKL 318


>SB_52862| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 469

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 40/165 (24%), Positives = 81/165 (49%), Gaps = 2/165 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R +K  +  A R D+ + +W+ +  +++ N M +++    +   ++HAP+   R++   +
Sbjct: 225 RKFKNFNSDAFRADIASLNWNFLNSYNDPNVMWDNWKEMFLHFVEKHAPLCTKRVRLSKS 284

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSL-ENR 393
           PW+  D+K LM           R    +   I+K  RN  N   + AK++Y+  +  EN 
Sbjct: 285 PWINSDLKKLMHQRDVFKIKAIRSKDVNDWKIFKKYRNFVNCQIKIAKQIYYDNAFRENE 344

Query: 392 -SPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDS 261
            +  +TW+ +  +   KT  S++K+  L   + H     +SLS++
Sbjct: 345 GNIRNTWKVINELISRKTNNSTIKEVKLD--DDHSITDSLSLSEA 387


>SB_8360| Best HMM Match : RVT_1 (HMM E-Value=3.6e-07)
          Length = 468

 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 59/239 (24%), Positives = 111/239 (46%), Gaps = 20/239 (8%)
 Frame = -3

Query: 668 NINDMVNSFNYKVISLFDQHAPVR---RVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRC 498
           N+ND+  SF   + ++ D+H P+R   R  IK    PW+T  I T +             
Sbjct: 19  NVNDIFQSFFSNISAIIDKHVPLRKRTRKEIKSLSKPWITKGIITSIKLKDKFYKKYLVS 78

Query: 497 PTEHSLAIYKALRNRCNRLCRDAKRLYFHK--SLENRSPAHTWRFLKSVGIGKTPVSSVK 324
            +E+ L+ YK  RN+ ++L R +K+ Y+    +  +++  + W  +K + I   P  S +
Sbjct: 79  RSEYYLSKYKCYRNKISQLIRTSKQNYYQNYFATNSKNIKNIWSGIKEL-ITTKPTCSNQ 137

Query: 323 DTDLCALNKHFSLP-PVSLSDSSKTATL-----LKI--------SSLSVPRIPIFELSPV 186
            + L   NK    P  ++++ ++  AT+      KI        S L  P +  F LSPV
Sbjct: 138 PSKLIINNKTVKDPKAIAIAFNNFFATIGSQFASKIPHVDRSPESFLGPPLVNSFVLSPV 197

Query: 185 SVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           +  ++ +    ++ S A G  ++   ++  +   ++  L  ++N SF++   PD  K A
Sbjct: 198 TAFEIEDIISGLNPSKASGPYSIPVCLLKFLKSYLSVPLEILYNHSFSNGCVPDQLKIA 256


>SB_6162| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1808

 Score = 61.3 bits (142), Expect = 8e-10
 Identities = 54/246 (21%), Positives = 104/246 (42%), Gaps = 8/246 (3%)
 Frame = -3

Query: 722  ALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKT 543
            A  R +   +W  +LE     +   +F+  +    D + P++  R+     PW+TPDIK 
Sbjct: 1155 AFGRWITAFNWDHVLELDTCQEKWTTFHRTISEAVDLYLPLKSRRVHETDRPWVTPDIKR 1214

Query: 542  LMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK---SLENRSPAHTWR 372
            L+                   A +K++ N+     ++ KR+++      L+  +P+  W+
Sbjct: 1215 LISERQKYLNKFG-----KDSAQFKSMSNKVQSRIKECKRIFYKSKVAKLKESNPSRWWK 1269

Query: 371  FLKSVGIGKTPVSSVKDTDLCALNKHFSL-PPVSLSDSSKTATLLKISSLSVPRIPIFEL 195
             +K +  G +   +   + L   +    L   ++    S T+    +S   V  I + E+
Sbjct: 1270 EIKKLS-GASCNDNHWYSQLATGSSVQELCERINTFFVSLTSEFSPLSVEDVAAIAVEEI 1328

Query: 194  SPVSVADVRNSFFSISS----TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPD 27
             P  +   R +  S+ S     A G D++ +K++      +API+ DI+N S    + P 
Sbjct: 1329 PPECIVTTREASLSLRSIQLRKAPGPDDIPNKVLKEFAFELAPIIADIYNASVREGSLPA 1388

Query: 26   SWKPAA 9
              K AA
Sbjct: 1389 ILKRAA 1394


>SB_49549| Best HMM Match : RVT_1 (HMM E-Value=3.6e-11)
          Length = 520

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 34/119 (28%), Positives = 62/119 (52%), Gaps = 2/119 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+ K +D  A  +D++   WS +    +++D V+ +N   +S+ D HAP+ R R+K +  
Sbjct: 190 RDCKKLDEEASLKDLDEAPWSVLDTFDDLDDAVDYWNLTFLSIADIHAPLIRKRVKKQSQ 249

Query: 569 P-WLTPDIKTLMXXXXXXXXXXXRCPT-EHSLAIYKALRNRCNRLCRDAKRLYFHKSLE 399
           P W+TP++   +           +C     +   +K+ RN   +  R+AKR +F+KS E
Sbjct: 250 PQWMTPELYAAIRDRDRLLERARKCNCGSDAWGTFKSARNNLFQSIREAKRNHFNKSFE 308


>SB_9264| Best HMM Match : DnaD (HMM E-Value=1.3)
          Length = 240

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 34/120 (28%), Positives = 55/120 (45%)
 Frame = -3

Query: 752 LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           +RN+K  D     +D+    W  I+  H+ N+M   +    +++ D+HAPV+  R K   
Sbjct: 114 IRNFKHFDQQKFVKDLLTQSWEQIVLCHDTNEMWAHWKDLFLNVLDRHAPVQSKRKKGFN 173

Query: 572 APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR 393
            PWLT +IK L+                +    +KA RN+ N   R AK  Y+   + N+
Sbjct: 174 VPWLTREIKDLINNRDKLKRKAMVSKLRNDWDDFKASRNKVNIALRQAKSNYYRNKIANQ 233


>SB_28047| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 962

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 57/248 (22%), Positives = 101/248 (40%), Gaps = 1/248 (0%)
 Frame = -3

Query: 752  LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
            +R+ +  D  A+  D+     S +    +    +   N  +    D+HAP++R ++   P
Sbjct: 386  IRDERNFDKHAITNDIKQLPLSIVYSTRDPEMQLEMLNTLLRECIDRHAPLKRTKVTRPP 445

Query: 572  APWLTP-DIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
            APWL   DI+ L            +  ++     ++  RN+   +   AKR +++K+L +
Sbjct: 446  APWLKELDIQKLQQDFRNMRTEARKEKSDSIWNYFREKRNQLKAMIGKAKRNFYYKALSS 505

Query: 395  RSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVP 216
                  WR +  + +   P     D D   LN HF+    S ++    ATL   + +S  
Sbjct: 506  VKAKDVWRVIHRI-LHPNPQPLRFDPD--ELNTHFA----STAERVTGATLTSANVIS-- 556

Query: 215  RIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSN 36
               + +  PVS A ++      S  + G   +  K I      +A  LT I N   +   
Sbjct: 557  --DLIQSLPVSTAALKK---LRSHCSCGPHGIPVKFIKHAADHLASPLTHILNTCISQEY 611

Query: 35   FPDSWKPA 12
            FP + K A
Sbjct: 612  FPSACKVA 619


>SB_31418| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 359

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 47/195 (24%), Positives = 84/195 (43%), Gaps = 5/195 (2%)
 Frame = -3

Query: 752 LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           +R+ +  D  A   D+     S +    +    +   N  +    D+HAP++R ++   P
Sbjct: 126 IRDERNFDEHAFTNDIEQLPLSIVYSTSDPEMQLEMLNTLLRECIDRHAPLKRTKVTRPP 185

Query: 572 APWLTP-DIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
           APWL   DI+ L            +  ++     ++  RN+   +   AKR +++K+L +
Sbjct: 186 APWLKELDIQNLQQDCRNMRTEARKDKSDSIWNSFREKRNQLKAMIGKAKRNFYYKALSS 245

Query: 395 RSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSL--S 222
                 WR +  + +   P     D D   LN HF+     ++ ++ T+    IS L  S
Sbjct: 246 VKAKEVWRVIHRI-LHPNPQPLRFDPD--ELNTHFASTAERVTGATPTSA-YNISDLIQS 301

Query: 221 VPRIPI--FELSPVS 183
           +P  P+  F L PVS
Sbjct: 302 LPEDPVWAFTLKPVS 316


>SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 1821

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 59/218 (27%), Positives = 96/218 (44%), Gaps = 21/218 (9%)
 Frame = -3

Query: 602  VRRVRIKHKPA---PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRD 432
            +R++    K A   PWLT +IK L+                +    +KA RN+ N   R 
Sbjct: 1157 IRKINPYRKKAFNVPWLTREIKDLINNRDKLKRKAMVSKLRNDWDDFKASRNKVNIALRQ 1216

Query: 431  AKRLYFHKSLENR--SPAHTWRFLKSVGIGK----TPVSSVKDTDLC---------ALNK 297
            AK  Y+   + N+  +P   W+ + S+ +G+    T V+ +K  D           A N 
Sbjct: 1217 AKSNYYRNKIANQKNNPKEAWKTINSL-LGRTKENTTVNELKFDDQSLFSQEHIAEAFND 1275

Query: 296  HFSL--PPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISST-AVGID 126
            +FS   P ++ S ++ + +          ++  F+L  VS   V      +S+  A GID
Sbjct: 1276 YFSNVGPKLASSMANPSKSFEHFIKPCSAQMSRFKL--VSNTKVLKLLGCLSNAKATGID 1333

Query: 125  NVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
             +  K++      ++P LT IFN S  S+ FPD WK A
Sbjct: 1334 KISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMA 1371



 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 24/72 (33%), Positives = 39/72 (54%)
 Frame = -3

Query: 752 LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           +RN+K  D     +D+    W  I+  H+ N+M   +    +++ D+HAPV+  R K   
Sbjct: 714 IRNFKHFDQQKFVKDLLTQSWEQIVLCHDTNEMWAHWKDLFLNVLDRHAPVQSKRKKAFN 773

Query: 572 APWLTPDIKTLM 537
            PWLT +IK L+
Sbjct: 774 VPWLTREIKDLI 785


>SB_58171| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 535

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 50/172 (29%), Positives = 81/172 (47%), Gaps = 18/172 (10%)
 Frame = -3

Query: 473 YKALRNRCNRLCRDAKRLYFHKSLE-NRS-PAHTWRFLKSV-GIG-KTPVSSVKDTDLCA 306
           Y+++RN+ +   + AK  +++   E N+S P   W+ +KS+ G   KT   S  +     
Sbjct: 165 YRSVRNKASNAIKSAKYKFYNSCFEENKSNPKGVWKIIKSLMGTDEKTEKRSTCNLSAND 224

Query: 305 LNKHFS---------LPPVSLSDSSKTATLLKISS----LSVPRIPI-FELSPVSVADVR 168
            N HF+         LP V    S     +L         S+PRIPI F ++ +   ++R
Sbjct: 225 FNVHFTSIADSLRNLLPSVPFDISKLEHFVLSRKDPETVFSIPRIPIGFTINCLQTLNLR 284

Query: 167 NSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
                    A+GID   +K++ L  P +AP ++ + N+S  SS FP  WK A
Sbjct: 285 K--------AMGIDKFSAKILKLAAPIIAPSISKLMNYSIESSEFPKRWKTA 328


>SB_56469| Best HMM Match : Exo_endo_phos (HMM E-Value=1.2e-12)
          Length = 652

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 34/119 (28%), Positives = 60/119 (50%), Gaps = 7/119 (5%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHH----NINDMVNSFNYKVISLFDQHAPVR---RV 591
           R++  +D  AL  D+ + +W  +L  +    N+ND+  SF   + ++ D+H P+R   R 
Sbjct: 526 RDFSKLDKEALLSDIQSINWIDVLPSNDGSKNVNDIFQSFFSNISAIIDKHVPLRKRTRK 585

Query: 590 RIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYF 414
            IK    PW+T  I T +              +E+ L+ YK  RN+ ++L R +K+ Y+
Sbjct: 586 EIKSLSKPWITKGIITSIKLKDKFYKKYLVSRSEYYLSKYKCYRNKISQLIRTSKQNYY 644


>SB_17727| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-12)
          Length = 648

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 61/252 (24%), Positives = 103/252 (40%), Gaps = 21/252 (8%)
 Frame = -3

Query: 710  DVNNTDWSCILEH-HNINDMVNSFNYKVISLFDQHAPVR---RVRIKHKPAPWLTPDIKT 543
            D+N  DW+ + +    +N+      + + S+ D+HAP++   R + +    PW+T  I  
Sbjct: 332  DMNQLDWNSLHQSTKTLNEKTEDTIHAIHSVIDKHAPMKIASRAKKRQLSKPWITNGILK 391

Query: 542  LMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK---SLENRSPAHTWR 372
             +               +  +  YK   N  + L   +K+ YFH    S +N   A TW+
Sbjct: 392  SIKHKQKMYRSHFFSKNQEKVIAYKQYSNTLSHLLNKSKKEYFHSQFISCKNNLKA-TWK 450

Query: 371  FLKSVGIGKTPVSSVKD------------TDLC-ALNKHFSLPPVSLSDSSKT-ATLLKI 234
             +  +   KT   S               +D+   LNK F+    +L+   K   ++   
Sbjct: 451  LIGKLIQRKTKGQSAPSRITSGNRSFTNPSDIADQLNKFFTNVGTNLASQIKDDKSISPT 510

Query: 233  SSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNF 54
            S +       F +SPVS A V + F S++     I  + +K I L    +A   T I+N 
Sbjct: 511  SYIKQSTTSSFVMSPVSEAQVFSLFASLNENKSYI-TIPNKFIKLSASILASPFTAIYNE 569

Query: 53   SFTSSNFPDSWK 18
            S  S   PD +K
Sbjct: 570  SIASGEVPDIFK 581


>SB_27891| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 609

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 51/254 (20%), Positives = 106/254 (41%), Gaps = 9/254 (3%)
 Frame = -3

Query: 746 NYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAP 567
           +YK  D   LR  +   D +  + H+++N     +    ++  + + P ++++ ++  +P
Sbjct: 228 DYKKGDFEGLRSALEAVDLANTIHHNDVNTSWREWKDTFLAAVNDYIPTKKIKGRNT-SP 286

Query: 566 WLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR-- 393
           W+  DI   +           + PT+     +K LR    R+ R ++  +F+ SL++   
Sbjct: 287 WINGDIIHALRKKKAVRKKLRKSPTDAFKDRFKELRAEAKRMIRSSRTDFFN-SLDDELC 345

Query: 392 -SPAHTWRF--LKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSK---TATLLKIS 231
            +P   W    LKS       + S+   +        +  P S++       ++  L   
Sbjct: 346 LNPKRFWSIFKLKSRDFRFPGIMSIGSAENSTQPARLASTPASIASLFNGYFSSLCLGSE 405

Query: 230 SLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIFNF 54
            L +  IP      +   +V+N+  ++  + A G D +  +++      +AP LT ++N 
Sbjct: 406 LLELVGIPHLSSVQLRTQEVQNALLALDVNEASGSDGIPCRLLKETAQQIAPSLTHLYNL 465

Query: 53  SFTSSNFPDSWKPA 12
           S      PD WK A
Sbjct: 466 SLRLGVVPDEWKLA 479


>SB_43796| Best HMM Match : SH2 (HMM E-Value=6.4)
          Length = 352

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 34/124 (27%), Positives = 63/124 (50%), Gaps = 2/124 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRI-KHKP 573
           R+ K +D  A  +D++   WS +    +++D V+ +N   + + D HAP+ R R+ K   
Sbjct: 45  RDCKKLDEEAFLKDLDEAPWSVLDTFDDLDDAVDYWNRTFLIIADIHAPLIRKRVKKQSQ 104

Query: 572 APWLTPDIKTLMXXXXXXXXXXXRCPTE-HSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
             W+TP++   +           +C ++  +   +K+ RN   +  R+AKR +F+KS E 
Sbjct: 105 QQWMTPELYAAIRDCDRLLERARKCNSDSDAWETFKSARNSVFQSIREAKRNHFNKSFEQ 164

Query: 395 RSPA 384
            S A
Sbjct: 165 SSTA 168


>SB_799| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 370

 Score = 58.4 bits (135), Expect = 6e-09
 Identities = 51/219 (23%), Positives = 93/219 (42%), Gaps = 14/219 (6%)
 Frame = -3

Query: 626 SLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCN 447
           ++ D+HAP+R +R++ + +PW+T ++K LM                +  A++K  RN  N
Sbjct: 56  AIADKHAPLRTMRVRGRRSPWITSELKDLMHSRDVLKIKATESKDPNDWALFKKQRNLVN 115

Query: 446 RLCRDAKRLYFHKSL-----ENRSPAHTWRFLKSVGIGKTPVSSV--------KDTDLC- 309
           +  R AK+ ++         ++RS   T   L S   GKT V+S+           +L  
Sbjct: 116 KEIRLAKQTHYQNRFNEHINDSRSTWKTINELTSRKSGKTSVTSLIVNGSSINNPLELSN 175

Query: 308 ALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGI 129
             N HF+     L+      +  +  + +  R  +       V  + N      S A G+
Sbjct: 176 EFNNHFANIGPKLASEIYCDSSQRYLTGTDKRFELHATDSNKVFSLLNKL--KKSKATGL 233

Query: 128 DNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           D + ++ +   +  +   ++ IFN S +    PD WK A
Sbjct: 234 DQISARFVRECVDLIFVPISHIFNRSISQGIVPDEWKYA 272


>SB_13020| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 722

 Score = 58.4 bits (135), Expect = 6e-09
 Identities = 61/252 (24%), Positives = 103/252 (40%), Gaps = 21/252 (8%)
 Frame = -3

Query: 710 DVNNTDWSCILEH-HNINDMVNSFNYKVISLFDQHAPVR---RVRIKHKPAPWLTPDIKT 543
           D+N  DW+ + +    +N+      + + S+ D+HAP++   R + +    PW+T  I  
Sbjct: 148 DMNQLDWNSLHQSTKTLNEKTEDTIHAIHSVIDKHAPMKIASRAKKRQLSKPWITNGILK 207

Query: 542 LMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK---SLENRSPAHTWR 372
            +               +  +  YK   N  + L   +K+ YFH    S +N   A TW+
Sbjct: 208 SIKHKQKMYRSHFFSKNQEKVIAYKQYSNTLSHLLIKSKKEYFHSQFISCKNNLKA-TWK 266

Query: 371 FLKSVGIGKTPVSSVKD------------TDLC-ALNKHFSLPPVSLSDSSKT-ATLLKI 234
            +  +   KT   S               +D+   LNK F+    +L+   K   ++   
Sbjct: 267 LIGKLIQRKTKGQSAPSRITSGNRSFTNPSDIADQLNKFFTNVGTNLASQIKDDKSISPT 326

Query: 233 SSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNF 54
           S +       F +SPVS A V + F S++     I  + +K I L    +A   T I+N 
Sbjct: 327 SYIKQSTTSSFVMSPVSEAQVFSLFASLNENKSYI-TIPNKFIKLSASILASPFTAIYNE 385

Query: 53  SFTSSNFPDSWK 18
           S  S   PD +K
Sbjct: 386 SIASGEVPDIFK 397


>SB_53688| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 491

 Score = 58.0 bits (134), Expect = 8e-09
 Identities = 61/252 (24%), Positives = 102/252 (40%), Gaps = 21/252 (8%)
 Frame = -3

Query: 710 DVNNTDWSCILEH-HNINDMVNSFNYKVISLFDQHAPVR---RVRIKHKPAPWLTPDIKT 543
           D+N  DW+ + +    +N+      + + S+ D+HAP++   R + +    PW+T  I  
Sbjct: 161 DMNQLDWNSLHQSTKTLNEKTEDTIHAIHSVIDKHAPMKIASRAKKRQLSKPWITNGILK 220

Query: 542 LMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK---SLENRSPAHTWR 372
            +               +  +  YK   N  + L   +K+ YFH    S +N   A TW+
Sbjct: 221 SIKHKQKMYRSHFFSKNQEKVIAYKQYSNTLSHLLNKSKKEYFHSQFISCKNNLKA-TWK 279

Query: 371 FLKSVGIGKTPVSSVKD------------TDLC-ALNKHFSLPPVSLSDSSKT-ATLLKI 234
            +  +   KT   S               +D+   LNK F+    +L+   K   ++   
Sbjct: 280 LIGKLIQRKTKGQSAPSRITSGNRSFTNPSDIADQLNKFFTNVGTNLASQIKDDKSISPT 339

Query: 233 SSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNF 54
           S +       F +SPVS A V   F S++     I  + +K I L    +A   T I+N 
Sbjct: 340 SYIKQSTTSSFVMSPVSEAQVFLLFASLNENKSYI-TIPNKFIKLSASILASPFTAIYNE 398

Query: 53  SFTSSNFPDSWK 18
           S  S   PD +K
Sbjct: 399 SIASGEVPDIFK 410


>SB_37633| Best HMM Match : DUF327 (HMM E-Value=2.1)
          Length = 355

 Score = 58.0 bits (134), Expect = 8e-09
 Identities = 50/172 (29%), Positives = 80/172 (46%), Gaps = 18/172 (10%)
 Frame = -3

Query: 473 YKALRNRCNRLCRDAKRLYFHKSLE-NRS-PAHTWRFLKSV-GIG-KTPVSSVKDTDLCA 306
           Y+++RN+     + AK  +++   E N+S P   W+ +KS+ G   KT   S  +     
Sbjct: 75  YRSVRNKAFNAIKSAKYKFYNSCFEENKSNPKGVWKIIKSLMGTDEKTEKRSTCNLSAND 134

Query: 305 LNKHFS---------LPPVSLSDSSKTATLLKISS----LSVPRIPI-FELSPVSVADVR 168
            N HF+         LP V    S     +L         S+PRIPI F ++ +   ++R
Sbjct: 135 FNVHFTSIADSLRNLLPSVPFDISKLEHFVLSRKDPETVFSIPRIPIGFTINCLQTLNLR 194

Query: 167 NSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
                    A+GID   +K++ L  P +AP ++ + N+S  SS FP  WK A
Sbjct: 195 K--------AMGIDKFSAKILKLAAPIIAPSISKLMNYSIESSEFPKRWKTA 238


>SB_10952| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-08)
          Length = 558

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 33/119 (27%), Positives = 60/119 (50%), Gaps = 7/119 (5%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHH----NINDMVNSFNYKVISLFDQHAPVR---RV 591
           R++  +D  AL  D+ + +W  +L  +    N+ND+  SF   + ++ D+H P+R   R 
Sbjct: 278 RDFSKLDKEALLSDIQSFNWIDVLPSNDGSKNVNDIFQSFFSNISAIIDKHVPLRKRTRK 337

Query: 590 RIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYF 414
            IK    PW+T  I T +              +E+ L+ YK  RN+ ++L R +K+ ++
Sbjct: 338 EIKSLSKPWITKGIITSIKLKDKFYKKYLVSRSEYYLSKYKCYRNKISQLIRTSKQNFY 396


>SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061)
          Length = 1445

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 60/262 (22%), Positives = 105/262 (40%), Gaps = 18/262 (6%)
 Frame = -3

Query: 743 YKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAP- 567
           +K  D    +  +++  WS +    + ND    FN   + + D  APV   R+     P 
Sbjct: 53  FKDFDAEGFQEQLDHCPWSVLDMCDDPNDAAEFFNKTFLDVADIFAPVSTKRVGRPQQPQ 112

Query: 566 WLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN--- 396
           W++P I   +               +   + YK  RN   +L R AK  +F ++LE    
Sbjct: 113 WMSPGIYEAIKHRDALLKKACASNYQADWSAYKQQRNATFQLIRKAKGSFFQEALETSES 172

Query: 395 -----RSP-----AHTWRF-LKSVGIGKTP--VSSVKDTDLC-ALNKHFSLPPVSLSDSS 258
                + P      H + F ++   I + P  +++  +   C   +K+ + PP + +   
Sbjct: 173 SKEYWKKPQECYGIHRYEFNIQGENISQNPTEIANAFNEFFCNVASKYRATPPGTSTCFE 232

Query: 257 KTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAP 78
           +  T +  +        I E++P  +     S   IS  A G+D + +K++ L  P +  
Sbjct: 233 RLKTFVGQTLKLEECFSIPEMTPDLIGRYL-STIKISK-ATGLDGISAKLLKLAGPAIDM 290

Query: 77  ILTDIFNFSFTSSNFPDSWKPA 12
            L  I N S   S FP  WK A
Sbjct: 291 PLCKIINLSIKQSIFPTIWKQA 312


>SB_12999| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-10)
          Length = 734

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 31/115 (26%), Positives = 61/115 (53%), Gaps = 2/115 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+ K +D  A  +D++   WS +    +++D V+ +N   +S+ D HAP+ R R+K +  
Sbjct: 619 RDCKKLDEEAFLKDLDEAPWSVLDTFDDLDDAVDYWNRTFLSIADIHAPLIRKRVKKQSQ 678

Query: 569 P-WLTPDIKTLMXXXXXXXXXXXRCPTE-HSLAIYKALRNRCNRLCRDAKRLYFH 411
           P W+TP++   +           +C ++  +   +K+ RN   +  R+AKR +F+
Sbjct: 679 PQWMTPELYAAIRDRDRLLERARKCNSDSDAWETFKSARNNVFQSIREAKRNHFN 733


>SB_56617| Best HMM Match : RVT_1 (HMM E-Value=0.04)
          Length = 447

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 48/169 (28%), Positives = 73/169 (43%), Gaps = 10/169 (5%)
 Frame = -3

Query: 479 AIYKALRNRCNRLCRDAKRLYFHKSLE---NRSPAHTWRFLKSVGIGKTPVSSVKDTDLC 309
           A +K LRN  NRL +  +  Y+   +E   N  P   W  +KS+   K+ V S   + L 
Sbjct: 45  AEFKRLRNHVNRLRKSCREKYYTSKVEHLRNCEPRKWWSEVKSLSGMKSAVRSDTRSVLK 104

Query: 308 ALNKHFSLPPVSLSDSSKTATLLKISSL------SVPRIPIFELSPVSVADVRNSFFSIS 147
            ++      P SL++    A L  ++S       + P IP  +   V+   V     S++
Sbjct: 105 HIDTGSDDDPASLANIINEAFLSPMASFTPLCADASPTIPPTDSPSVTELGVLKKLSSLN 164

Query: 146 ST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPAAAD 3
           +T A G D V   ++      + P +T I N SF     P SWK A  D
Sbjct: 165 TTKATGPDGVPGWLLKENADLLVPAVTSIINTSFAEGRLPQSWKHADVD 213


>SB_48302| Best HMM Match : HORMA (HMM E-Value=1.1)
          Length = 330

 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 60/251 (23%), Positives = 101/251 (40%), Gaps = 21/251 (8%)
 Frame = -3

Query: 707 VNNTDWSCILEH-HNINDMVNSFNYKVISLFDQHAPVR---RVRIKHKPAPWLTPDIKTL 540
           +N  DW+ + +    +N+      + + S+ D+HAP++   R + +    PW+T  I   
Sbjct: 1   MNQLDWNSLHQSTKTLNEKTEDTIHAIHSVIDKHAPMKIASRAKKRQLSKPWITNGILKS 60

Query: 539 MXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK---SLENRSPAHTWRF 369
           +               +  +  YK   N  + L   +K+ YFH    S +N   A TW+ 
Sbjct: 61  IKHKQKMYRNHFFSKNQEKVIAYKQYSNTLSHLLNKSKKEYFHSQFISCKNNLKA-TWKL 119

Query: 368 LKSVGIGKTPVSSVKD------------TDLC-ALNKHFSLPPVSLSDSSKT-ATLLKIS 231
           +  +   KT   S               +D+   LNK F+    +L+   K   ++   S
Sbjct: 120 IGKLIQRKTKGQSAPSRITSGNRSFTNPSDIADQLNKFFTNVGTNLASQIKDDKSISPTS 179

Query: 230 SLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFS 51
            +       F +SPVS A V   F S++     I  + +K I L    +A   T I+N S
Sbjct: 180 YIKQSTTSSFVMSPVSEAQVFLLFASLNENKSYI-TIPNKFIKLSASILASPFTAIYNES 238

Query: 50  FTSSNFPDSWK 18
             S   PD +K
Sbjct: 239 IASGEVPDIFK 249


>SB_54849| Best HMM Match : HORMA (HMM E-Value=0.54)
          Length = 330

 Score = 55.6 bits (128), Expect = 4e-08
 Identities = 60/251 (23%), Positives = 101/251 (40%), Gaps = 21/251 (8%)
 Frame = -3

Query: 707 VNNTDWSCILEH-HNINDMVNSFNYKVISLFDQHAPVR---RVRIKHKPAPWLTPDIKTL 540
           +N  DW+ + +    +N+      + + S+ D+HAP++   R + +    PW+T  I   
Sbjct: 1   MNQLDWNSLHQSTKTLNEKTEDTIHAIHSVIDKHAPMKIASRAKKRQLSKPWITNGILKS 60

Query: 539 MXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK---SLENRSPAHTWRF 369
           +               +  +  YK   N  + L   +K+ YFH    S +N   A TW+ 
Sbjct: 61  IKHKQKMYRSHFFSKNQEKVIAYKQYSNTLSHLLNKSKKEYFHSQFISCKNNLKA-TWKL 119

Query: 368 LKSVGIGKTPVSSVKD------------TDLC-ALNKHFSLPPVSLSDSSKT-ATLLKIS 231
           +  +   KT   S               +D+   LNK F+    +L+   K   ++   S
Sbjct: 120 IGKLIQRKTKGQSAPSRITSGNRSFTNPSDIADQLNKFFTNVGTNLASQIKDDKSISPTS 179

Query: 230 SLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFS 51
            +       F +SPVS A V   F S++     I  + +K I L    +A   T I+N S
Sbjct: 180 YIKQSTTSSFVMSPVSEAQVFLLFASLNENKSYI-TIPNKFIKLSASILASPFTAIYNES 238

Query: 50  FTSSNFPDSWK 18
             S   PD +K
Sbjct: 239 IASGEVPDIFK 249


>SB_54673| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 337

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 38/139 (27%), Positives = 63/139 (45%), Gaps = 2/139 (1%)
 Frame = -3

Query: 752 LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           +RN+K  D     +D+    W  I+  H+ N+M   +    +++ D+HAPV+  R K   
Sbjct: 164 IRNFKHFDQQKFVKDLLTQSWEQIVLCHDTNEMWAHWKNLFLNVLDRHAPVQSKRKKAFN 223

Query: 572 APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR 393
            PWLT +IK L+                       A RN+ N   R AK  Y+   + N+
Sbjct: 224 VPWLTREIKDLINNRDKLKRKA------------MASRNKVNIALRQAKSNYYRNKIANQ 271

Query: 392 --SPAHTWRFLKSVGIGKT 342
             +P   W+ + S+ +G+T
Sbjct: 272 KNNPKEAWKTINSL-LGRT 289


>SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2209

 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 48/255 (18%), Positives = 107/255 (41%), Gaps = 10/255 (3%)
 Frame = -3

Query: 746  NYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAP 567
            +YK  D   LR  +   D +  + H+++N     +    ++  + + P ++++ ++ P P
Sbjct: 1305 DYKKGDFEGLRSALEAVDLANTIHHNDVNTSWQEWKDTFLAAVNDYIPTKKIKERNTP-P 1363

Query: 566  WLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRSP 387
            W+   I   +           + PT+     +K LR    R+ R ++  +F+ S+++   
Sbjct: 1364 WINGGIIHALGKKEAMRKKLRKSPTDALKDRFKELRAEAKRMIRSSRTDFFN-SMDDELC 1422

Query: 386  AHTWRFLKSVGIGKTP-------VSSVKDTDLCALNKHFS--LPPVSLSDSSKTATLLKI 234
             +  RF   + +G          ++S   +     N +FS    P +L+          +
Sbjct: 1423 LNRKRFWNHMSVGSAENSTQPARLASTPASIASLFNGYFSSVFGPSALAHPLPYQGSELL 1482

Query: 233  SSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIFN 57
              +  P +   +L      +V+N+  ++  + A+G + +  +++      +AP LT ++N
Sbjct: 1483 ELVGAPHLSSVQLR---TQEVQNALLALDVNKALGSNGIPCRLLKETAQQIAPSLTQLYN 1539

Query: 56   FSFTSSNFPDSWKPA 12
             S      PD WK A
Sbjct: 1540 LSLRLGVVPDKWKLA 1554


>SB_38561| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4)
          Length = 432

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 51/180 (28%), Positives = 79/180 (43%), Gaps = 26/180 (14%)
 Frame = -3

Query: 473 YKALRNRCNRLCRDAKRLYFHKSLENRSPAHT-WRFLKSVGIGKTPVSSVKD-------- 321
           +K+ RN   +  R+AKR +F+KS E  S A   WR+LK + IG+T   S           
Sbjct: 224 FKSARNNVFQSIREAKRNHFNKSFEQSSTAKEFWRYLK-IAIGQTSKPSPSQLRGNASNT 282

Query: 320 ---TD----LCALNKHFSLPPVSLSDSS------KTATLLKISSLSVPRIPI---FELSP 189
              TD      A N+ F     +  +S+       T+   K+      +IP    FE+  
Sbjct: 283 PTITDPREIANAFNEFFVSVAATYRNSNVNMRTLSTSDFEKLKGFVDSKIPSGTKFEIPK 342

Query: 188 VSVADVRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           V    V+     + +  A G+D + ++++    P +AP LT I N S  +  FP  WK A
Sbjct: 343 VMQEFVQGYLLQLQTCKATGLDGISARLLRAAAPAIAPSLTKIINQSIKTGRFPARWKEA 402


>SB_26795| Best HMM Match : Exo_endo_phos (HMM E-Value=6.3e-10)
          Length = 609

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 33/135 (24%), Positives = 62/135 (45%), Gaps = 4/135 (2%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVR-RVRIKHKP 573
           RN+KG +L   + D++  +WS +      N+M  ++    +S+ D+HAP + R +   K 
Sbjct: 403 RNFKGFNLNLFKEDLDKCNWSTLDNFSEPNEMWLNWKKIFLSVLDKHAPTKTRFKCAKKS 462

Query: 572 APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK---SL 402
            PW+  D++ L            +   E     Y+A RN+ N   + A ++ F+K   S 
Sbjct: 463 NPWMNADLRKLTFARDTARRKAIKTGAEVDWNEYRAQRNKVNGAIK-ATKVAFYKDRFSQ 521

Query: 401 ENRSPAHTWRFLKSV 357
           +      TW+ +  +
Sbjct: 522 QKGDLRSTWKTINEL 536


>SB_20796| Best HMM Match : RVT_1 (HMM E-Value=0.047)
          Length = 660

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 56/264 (21%), Positives = 113/264 (42%), Gaps = 20/264 (7%)
 Frame = -3

Query: 743 YKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPW 564
           YK  DL  LR  +   D +  + H+++N     +    ++  + + P ++++ ++ P PW
Sbjct: 204 YKKGDLEGLRSALEAVDLANTIHHNDVNTSWQEWKDTFLAAVNDYIPTKKIKGRNTP-PW 262

Query: 563 LTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPA 384
           +  DI   +           + PT+     +K LR    R+ R ++  +F+ S+++    
Sbjct: 263 INGDIIHALRKKEAMRKKLRKSPTDALKDRFKELRAEAKRMIRSSRTDFFN-SMDDELCL 321

Query: 383 HTWRF-----LKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSD--SSKTATLLKISSL 225
           +  RF     LKS       + SV   +        +  P S++   +   +++   S+L
Sbjct: 322 NRKRFWCIFKLKSRDSRFPGIMSVGSAENSTQPARLASTPASIASLFNGYFSSVFGPSAL 381

Query: 224 SVPR----------IPIFELSPVSVA--DVRNSFFSIS-STAVGIDNVCSKMIALILPTV 84
           + P           +    LS V +   +V+N+  ++  + A G D +  +++      +
Sbjct: 382 AHPLPYQGSELLELVGAPHLSSVQLRTQEVQNALLALDVNKASGSDGIPCRLLKETAQQI 441

Query: 83  APILTDIFNFSFTSSNFPDSWKPA 12
           AP LT ++N SF     PD WK A
Sbjct: 442 APSLTHLYNLSFRLGVVPDEWKLA 465


>SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08)
          Length = 993

 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 53/215 (24%), Positives = 96/215 (44%), Gaps = 21/215 (9%)
 Frame = -3

Query: 593  VRIKHKPA---PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKR 423
            V++K K A   PW+T +I+ L+                    +YK+ RN+ N   + AK 
Sbjct: 657  VQLKKKKAFSDPWVTKEIRELIIHRDKAKRKAVVSKLSSDWEVYKSFRNKVNIALQQAKS 716

Query: 422  LYFHKSL--ENRSPAHTWRFLKSV---GIGKTPVSSVKDTDLC---------ALNKHFSL 285
             ++   +  +  +P   W+ + ++     G++ V+  K  D           A N +FS 
Sbjct: 717  DFYRNKVASQENNPKEAWKTINNLLGRNSGQSVVNEQKINDQSISSPEEIAEAFNSYFSN 776

Query: 284  PPVSLSDS---SKTATLLKISSLSVPRIPIFELS-PVSVADVRNSFFSISSTAVGIDNVC 117
               +L++S   + T+    + S  V  +  F+LS P  V  + ++  S  +T  GID   
Sbjct: 777  IGPNLANSMPPTNTSFESFVESCQV-NMTHFKLSFPNKVLKLLSNLSSPKAT--GIDKNS 833

Query: 116  SKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
             K++     +++P L+ IFN +  +  FPD WK A
Sbjct: 834  GKILKAAASSISPSLSYIFNNAIITCCFPDEWKMA 868


>SB_21074| Best HMM Match : NadA (HMM E-Value=2)
          Length = 358

 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 67/260 (25%), Positives = 114/260 (43%), Gaps = 19/260 (7%)
 Frame = -3

Query: 734 IDLGALRRDVNN--TDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWL 561
           +D+  L RD     +++    E  ++    + F   ++S  ++H P +  + K    PW+
Sbjct: 1   MDVEGLHRDAMTLASEFFSSCESRSVESNWSHFKNGLLSAVEKHVPSKLTKSKLS-LPWM 59

Query: 560 TPDIKTLMXXXXXXXXXXXRCPTEHSLA--IYKALRNRCNRLCRDAKRLYFH----KSLE 399
           +P IK LM           R   + S     Y+  RN+  +  + A   Y +    +SL+
Sbjct: 60  SPTIKRLMRKRDSLLLRAKRSNNKSSEVWRAYRQQRNKVVKALKVAHNNYLNDVIGESLQ 119

Query: 398 NRSPAHTWRFLK-----SVGIG---KTPVSSVKDTDLC-ALNKHFSLPPVSLSDSSKTAT 246
           +  P   WR++K     +VGI    K  +  + D D   ALN HF    V  SD+ +   
Sbjct: 120 S-DPKKFWRYVKRSRSENVGIPTLHKDNMLFISDADKAEALNHHFQ--SVFTSDNGQ--- 173

Query: 245 LLKISSLSVPRIP-IFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPIL 72
           L  +S+ S P I  I    P     +R    S++ S +VG D +  +++  +   ++ +L
Sbjct: 174 LPDLSTSSYPTIKDIIFTEP----GIRKQLESLNPSKSVGPDGLSPRILRDLSSEISNVL 229

Query: 71  TDIFNFSFTSSNFPDSWKPA 12
           T IF  SF S   P+ W  A
Sbjct: 230 TFIFQQSFDSGILPEDWLKA 249


>SB_28351| Best HMM Match : Exo_endo_phos (HMM E-Value=0.041)
          Length = 607

 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 63/256 (24%), Positives = 106/256 (41%), Gaps = 10/256 (3%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEH-HNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
            R+ +     AL R + + DWS +     + + M N+F   V +  D   P +   I    
Sbjct: 329  RDLRTSSKAALGRYLISIDWSLLFAPLSDCDQMWNTFIEVVSTGLDIIMPEKEYHICAAD 388

Query: 572  APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR 393
            APW+TP +K+++             P       ++ + NR  ++CR        K L+  
Sbjct: 389  APWMTPGLKSIILKRQEAFKNHG--PESVQFKFFRNMVNRERKVCRSRFYDSKVKQLKGE 446

Query: 392  SPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATL--LKISSLSV 219
            +P   W  +K +   K  V++   T    +     L     ++   +A+L  L++  L+ 
Sbjct: 447  NPKKWWDEVKRLCGAK--VTNRDLTTQINIENFSELLMQDQANRINSASLEPLEVYRLNE 504

Query: 218  P--RIPIFELSPVSVADVRNSFFSISST-----AVGIDNVCSKMIALILPTVAPILTDIF 60
            P  R P+ E  PV ++   +S   + S      A G DNV S ++  I   +A  +T I 
Sbjct: 505  PLERFPL-EDEPVFLSVTEDSVQKVLSKLHPRKASGPDNVPSWLLKEISDIMAQPITQIL 563

Query: 59   NFSFTSSNFPDSWKPA 12
            N SF     P  WK A
Sbjct: 564  NASFKDQRLPPIWKMA 579


>SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 623

 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 49/172 (28%), Positives = 80/172 (46%), Gaps = 18/172 (10%)
 Frame = -3

Query: 473 YKALRNRCNRLCRDAKRLYFHKSLENR--SPAHTWRFLKSVGIGK----TPVSSVKDTDL 312
           +KA RN+ N   R AK  Y+   + N+  +P   W+ + S+ +G+    T V+ +K  D 
Sbjct: 12  FKASRNKVNIALRQAKSNYYRNKIANQKNNPKEAWKTINSL-LGRTKENTTVNELKFDDQ 70

Query: 311 C---------ALNKHFSL--PPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRN 165
                     A N +FS   P ++ S ++ + +          ++  F+L  VS   V  
Sbjct: 71  SLFSQEHIAEAFNDYFSNVGPKLASSMANPSKSFEHFIKPCSAQMSRFKL--VSNTKVLK 128

Query: 164 SFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
               +S+  A GID +  K++      ++P LT IFN S  S+ FPD WK A
Sbjct: 129 LLGCLSNAKATGIDKISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMA 180


>SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34)
          Length = 875

 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 49/172 (28%), Positives = 80/172 (46%), Gaps = 18/172 (10%)
 Frame = -3

Query: 473 YKALRNRCNRLCRDAKRLYFHKSLENR--SPAHTWRFLKSVGIGK----TPVSSVKDTDL 312
           +KA RN+ N   R AK  Y+   + N+  +P   W+ + S+ +G+    T V+ +K  D 
Sbjct: 12  FKASRNKVNIALRQAKSNYYRNKIANQKNNPKEAWKTINSL-LGRTKENTTVNELKFDDQ 70

Query: 311 C---------ALNKHFSL--PPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRN 165
                     A N +FS   P ++ S ++ + +          ++  F+L  VS   V  
Sbjct: 71  SLFSQEHIAEAFNDYFSNVGPKLASSMANPSKSFEHFIKPCSAQMSRFKL--VSNTKVLK 128

Query: 164 SFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
               +S+  A GID +  K++      ++P LT IFN S  S+ FPD WK A
Sbjct: 129 LLGCLSNAKATGIDKISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMA 180



 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = -3

Query: 149 SSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           ++ A GID +  K++      ++P LT IFN S  S+ FPD WK A
Sbjct: 424 NAKATGIDKISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMA 469


>SB_9596| Best HMM Match : BAF (HMM E-Value=1.54143e-44)
          Length = 759

 Score = 52.0 bits (119), Expect = 5e-07
 Identities = 49/172 (28%), Positives = 80/172 (46%), Gaps = 18/172 (10%)
 Frame = -3

Query: 473 YKALRNRCNRLCRDAKRLYFHKSLENR--SPAHTWRFLKSVGIGK----TPVSSVKDTDL 312
           +KA RN+ N   R AK  Y+   + N+  +P   W+ + S+ +G+    T V+ +K  D 
Sbjct: 287 FKASRNKVNIALRQAKSNYYRNKIANQKNNPKEAWKTINSL-LGRTKENTTVNELKFDDQ 345

Query: 311 C---------ALNKHFSL--PPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRN 165
                     A N +FS   P ++ S ++ + +          ++  F+L  VS   V  
Sbjct: 346 SLFSQEHIAEAFNDYFSNVGPKLASSMANPSKSFEHFIKPCSAQMSRFKL--VSNTKVLK 403

Query: 164 SFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
               +S+  A GID +  K++      ++P LT IFN S  S+ FPD WK A
Sbjct: 404 LLGCLSNAKATGIDKISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMA 455


>SB_22732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-23)
          Length = 457

 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 28/122 (22%), Positives = 61/122 (50%), Gaps = 4/122 (3%)
 Frame = -3

Query: 710 DVNNTDWSCILEHHNINDMVNSFNYKVIS-LFDQHAPVRRVRIKHKPAP-WLTPDIKTLM 537
           D++   WS +  + ++ND ++ + YK+ + +   HAP++  RIK    P W   +I   +
Sbjct: 3   DLSLVPWSTLDIYDDVNDALDQW-YKLFNDILTVHAPIKEHRIKRPLKPDWFNAEISAAI 61

Query: 536 XXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN--RSPAHTWRFLK 363
                         T+ S + Y+  RN    L R AK+ +++ +++N   +P + W+ ++
Sbjct: 62  KARNCLHRIATSLKTDTSWSEYRRARNHVVHLIRKAKKTFYNDAIKNNLENPKNLWKIIR 121

Query: 362 SV 357
           ++
Sbjct: 122 NI 123


>SB_21644| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 787

 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 33/134 (24%), Positives = 62/134 (46%), Gaps = 3/134 (2%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+ +   L +L   +   +W C+L   ++N+ V+SF        +   P RRVR+     
Sbjct: 573 RDLRESSLCSLGSWLTTFNWDCVLNLSSVNEKVHSFYEIFCKAIEIFLPARRVRVCSSDK 632

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFH---KSLE 399
           PW++  +K+L+                   AI+K  RN+  +  R+ KR YF+    SL+
Sbjct: 633 PWVSSRLKSLVSRRQSAFKALG-----KDSAIFKMFRNKVQKEARNCKRSYFNSKVSSLK 687

Query: 398 NRSPAHTWRFLKSV 357
           + + +  W  +K++
Sbjct: 688 DTNVSKWWAEVKAL 701


>SB_36459| Best HMM Match : FlgN (HMM E-Value=2.2)
          Length = 354

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 49/172 (28%), Positives = 80/172 (46%), Gaps = 18/172 (10%)
 Frame = -3

Query: 473 YKALRNRCNRLCRDAKRLYFHKSLENR--SPAHTWRFLKSVGIGK----TPVSSVKDTDL 312
           +KA RN+ N   R AK  Y+   + N+  +P   W+ + S+ +G+    T V+ +K  D 
Sbjct: 12  FKASRNKVNIALRQAKSNYYCNKIANQKNNPKEAWKTINSL-LGRTKENTTVNELKFDDQ 70

Query: 311 C---------ALNKHFSL--PPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRN 165
                     A N +FS   P ++ S ++ + +          ++  F+L  VS   V  
Sbjct: 71  SLFSQEHIAEAFNDYFSNVGPKLASSMANPSKSFEHFIKPCSAQMSRFKL--VSNTKVLK 128

Query: 164 SFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
               +S+  A GID +  K++      ++P LT IFN S  S+ FPD WK A
Sbjct: 129 LLGCLSNAKATGIDKISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMA 180


>SB_29863| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 590

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 28/133 (21%), Positives = 56/133 (42%), Gaps = 1/133 (0%)
 Frame = -3

Query: 752 LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           +R+ +  D  A   D+     S +    +    +   N  +    D+HAP++R ++   P
Sbjct: 405 IRDERNFDEHAFTNDIEQLPLSIVYSTSDPEMQLEMLNTLLRECIDRHAPLKRTKVTRPP 464

Query: 572 APWLTP-DIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
           APWL   DI+ L            +  ++     ++  RN+   +   AKR +++K+L +
Sbjct: 465 APWLKELDIQNLQQDCRNMRTEARKDKSDSIWNSFREKRNQLKAMIGKAKRNFYYKALSS 524

Query: 395 RSPAHTWRFLKSV 357
                 WR +  +
Sbjct: 525 VKAKEVWRVIHRI 537


>SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42)
          Length = 715

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 55/256 (21%), Positives = 101/256 (39%), Gaps = 11/256 (4%)
 Frame = -3

Query: 746 NYKGIDLGALRRDVNNTDWS-CILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           N+K  D   L   + N  W  C  +  NI+  + ++    ++   +H P  + R      
Sbjct: 229 NFKRADWTGLNESLKNIPWDLCFSQSDNIDSSLANWTDLFLAAVIEHIPKSKPR-NVSDY 287

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK--SLEN 396
           PW+  ++++L+           +  +  +   Y  LR    ++    K+ +  K  S+ +
Sbjct: 288 PWIDHELRSLLKKKDAQRKKANKTGSLAAERKYNELRRAAKQMLSKKKKEHDEKLKSVIS 347

Query: 395 RSPAHTWRFLKSVGIGKTPVSSVKD-----TD---LCALNKHFSLPPVSLSDSSKTATLL 240
            +P   W ++KS    K   +  +D     TD   +  LN+HF     S S S +     
Sbjct: 348 DNPKRFWTYVKSCTSNKPSPNFFRDGHAFVTDTKNMALLNRHFH-HIFSPSASEEFVRAQ 406

Query: 239 KISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIF 60
             +   V  +   +L+   V DV  +  S    A G D +   ++      +AP L  +F
Sbjct: 407 PTNREPVLGLGSIQLTVPEVLDVLRNLDS--HKACGTDQIPGILLKNTAHQIAPSLCRLF 464

Query: 59  NFSFTSSNFPDSWKPA 12
           N S +  + P  WK A
Sbjct: 465 NLSLSLGSVPALWKDA 480


>SB_17745| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 567

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 34/127 (26%), Positives = 58/127 (45%), Gaps = 4/127 (3%)
 Frame = -3

Query: 722 ALRRDVNNTDWSCILEHHNINDMVNSFNYKVI-SLFDQHAPVRRVRIKHKPAPWLTPDIK 546
           A  R +   DW C+       D +N   YK++ S  D + P++R+++     PW+TP I 
Sbjct: 313 AFGRWITGFDWGCVTNLTCTEDKLNEL-YKILTSAIDSYLPLQRLKVCCTSKPWVTPKIT 371

Query: 545 TLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK---SLENRSPAHTW 375
            L+           +   E     YK +RNR  R C  AK  ++     +L++ + +  W
Sbjct: 372 ALISKRQKALSHHGKDFRE-----YKEMRNRVQRECVSAKEKFYKNKVVALKDSNVSKWW 426

Query: 374 RFLKSVG 354
             +KS+G
Sbjct: 427 GSVKSLG 433


>SB_12862| Best HMM Match : Ribosomal_S6 (HMM E-Value=3)
          Length = 224

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 2/93 (2%)
 Frame = -3

Query: 629 ISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRC 450
           + + D++AP++R +++ +  PWLT +IKTL+                     YK  RN+ 
Sbjct: 20  LEVLDKYAPLQRKKLRRRSIPWLTGEIKTLINTRDRIKRKAIITNNSVHWESYKHARNKV 79

Query: 449 NRLCRDAKRLYFHKSL--ENRSPAHTWRFLKSV 357
           N   R+AK  Y+   +  E+ +P   W+ +  +
Sbjct: 80  NIALREAKSNYYKNKIAQEHDNPKEAWKIINDL 112


>SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 796

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 45/164 (27%), Positives = 70/164 (42%), Gaps = 10/164 (6%)
 Frame = -3

Query: 479 AIYKALRNRCNRLCRDAKRLYFHKSLE---NRSPAHTWRFLKSVGIGKTPVSSVKDTDLC 309
           A +K LRN  NRL +  +  Y+   +E   N  P   W  +KS+   K+ V S   + L 
Sbjct: 224 AEFKRLRNHVNRLRKSCREKYYTSKVEHLRNCEPRKWWSEVKSLSGMKSAVRSDTRSVLK 283

Query: 308 ALNKHFSLPPVSLSDSSKTATLLKISSLSV------PRIPIFELSPVSVADVRNSFFSIS 147
            ++      P SL++    A L  ++  +       P IP  +   V+   V     S++
Sbjct: 284 HIDTGSDDDPASLANIINEAFLAPMAFFTPLCADASPTIPPTDSPSVTELGVLKKLSSLN 343

Query: 146 ST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
           +T A   D V   ++      +AP +T I N SF     P SWK
Sbjct: 344 TTKATRPDGVPGWLLKENADLLAPAVTSIINTSFAEGRLPQSWK 387


>SB_18820| Best HMM Match : FCH (HMM E-Value=5.4e-20)
          Length = 477

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 43/208 (20%), Positives = 87/208 (41%), Gaps = 16/208 (7%)
 Frame = -3

Query: 593 VRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYF 414
           ++IK +P P++TP+IK LM           +   +     Y+  R    R+ R A++ + 
Sbjct: 265 IKIKFRPNPFVTPEIKALMKTCDNWHKKACKSNGKLDWNGYRFFRQEVKRVLRLAEKDHI 324

Query: 413 HKSLE--NRSPAHTWRFLKSVGIGKTPVSSVKDTDLC---ALNKHFSLPPVSLSDSSKTA 249
              L   N +   TW+ +      + P+ +     +      N+ +     S ++++K  
Sbjct: 325 RSELNKCNGNTNSTWKVINRCLPSRDPLLTTTQDPVAQANRFNEFYVSVGKSAAENAKAI 384

Query: 248 TL----------LKISSLSVPRIPIFELSPVSVADVRNSFFSI-SSTAVGIDNVCSKMIA 102
           ++            + +     I  FE   V+  DV      + S+ A G+D + ++++ 
Sbjct: 385 SVQHSFGQLQPDFLLETEDSSNIKKFEFHAVTEQDVGKIVMCLPSNKASGLDKISAQVLK 444

Query: 101 LILPTVAPILTDIFNFSFTSSNFPDSWK 18
             LP + P+ T++ N  F S+ F   WK
Sbjct: 445 DSLPAMLPVFTNLINALFVSNCFAQKWK 472


>SB_50658| Best HMM Match : Pox_D2 (HMM E-Value=4.7)
          Length = 175

 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 34/134 (25%), Positives = 63/134 (47%), Gaps = 2/134 (1%)
 Frame = -3

Query: 656 MVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLA 477
           M N++    +   ++HAP    R++   +PW+  D+K LM           R    +   
Sbjct: 1   MWNNWKEMFLHFVEKHAPFCAKRVRLSKSPWINSDLKKLMHQRVVFKIKAIRSKDVNDWK 60

Query: 476 IYKALRNRCNRLCRDAKRLYFHKSL-ENR-SPAHTWRFLKSVGIGKTPVSSVKDTDLCAL 303
           I+K  RN  N   + AK++Y+  +  EN  +  +TW+ +  +   KT  S++K+  L   
Sbjct: 61  IFKKYRNFVNCQIKIAKQIYYDNAFRENEGNIRNTWKVINELTSRKTNNSTIKEVKLD-- 118

Query: 302 NKHFSLPPVSLSDS 261
           + H     +SLS++
Sbjct: 119 DDHSITDSLSLSEA 132


>SB_39669| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 566

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = -3

Query: 224 SVPRIPI-FELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSF 48
           S+PRIPI F ++ +   ++R         A+GID   +K++ L  P +AP ++ + N+S 
Sbjct: 210 SIPRIPIGFTINCLQTLNLRK--------AMGIDKFSAKILKLAAPIIAPSISKLMNYSI 261

Query: 47  TSSNFPDSWKPA 12
            SS FP  WK A
Sbjct: 262 ESSEFPKRWKTA 273



 Score = 36.7 bits (81), Expect = 0.020
 Identities = 17/72 (23%), Positives = 30/72 (41%), Gaps = 1/72 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKH-KP 573
           R  K +D       +    W        I+D++ ++      + D H P R  R+   KP
Sbjct: 108 RRMKDLDESRFLSTLKTISWDTAFLFDTIDDILGAWEQLFNGVLDNHCPWREKRVARVKP 167

Query: 572 APWLTPDIKTLM 537
            PW+T ++  L+
Sbjct: 168 TPWITKEVLQLI 179


>SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43)
          Length = 593

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = -3

Query: 224 SVPRIPI-FELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSF 48
           S+PRIPI F ++ +   ++R         A+GID   +K++ L  P +AP ++ + N+S 
Sbjct: 60  SIPRIPIGFTINCLQTLNLRK--------AMGIDKFSAKILKLAAPIIAPSISKLMNYSI 111

Query: 47  TSSNFPDSWKPA 12
            SS FP  WK A
Sbjct: 112 ESSEFPKRWKTA 123


>SB_12012| Best HMM Match : DUF327 (HMM E-Value=2)
          Length = 232

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = -3

Query: 224 SVPRIPI-FELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSF 48
           S+PRIPI F ++ +   ++R         A+GID   +K++ L  P +AP ++ + N+S 
Sbjct: 60  SIPRIPIGFTINCLQTLNLRK--------AMGIDKFIAKILKLAAPIIAPSISKLMNYSI 111

Query: 47  TSSNFPDSWKPA 12
            SS FP  WK A
Sbjct: 112 ESSEFPKRWKTA 123


>SB_51484| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0036)
          Length = 283

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 24/72 (33%), Positives = 39/72 (54%)
 Frame = -3

Query: 752 LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           +RN+K  D     +D+    W  I+  H+ N+M   +    +++ D+HAPV+  R K   
Sbjct: 201 IRNFKHFDQQKFVKDLLTQSWEQIVLCHDTNEMWAHWKDLFLNVLDRHAPVQSKRKKAFN 260

Query: 572 APWLTPDIKTLM 537
            PWLT +IK L+
Sbjct: 261 VPWLTREIKDLI 272


>SB_49126| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 559

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 50/205 (24%), Positives = 83/205 (40%), Gaps = 7/205 (3%)
 Frame = -3

Query: 605 PVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAK 426
           P +   I    APW+TP +K+++             P       ++ + NR  ++CR   
Sbjct: 2   PEKEYHICAADAPWMTPGLKSIILKRQEAFINHG--PESVQFKFFRNMVNRERKVCRSRF 59

Query: 425 RLYFHKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTAT 246
                K L+  +P   W  +K +   K    + +D       ++FS PP+    +S    
Sbjct: 60  YDLKVKQLKGENPKKWWDEVKRLCGAKV---TYRDLTTQINIENFSEPPMQDQVNSAFLE 116

Query: 245 LLKISSLSVP--RIPIFELSPVSVADVRNSFFSISST-----AVGIDNVCSKMIALILPT 87
            L++  L+ P  R P+ E  PV ++   +    + S      A G DNV S ++      
Sbjct: 117 PLEVYRLNEPLERFPL-EDKPVFLSVTEDRVQKVLSKLHPRKASGPDNVPSWLLKEFSDI 175

Query: 86  VAPILTDIFNFSFTSSNFPDSWKPA 12
           +A  +T I N SF     P  WK A
Sbjct: 176 MAQPITQILNASFKDQRLPPIWKMA 200


>SB_29903| Best HMM Match : SAP (HMM E-Value=2.2e-11)
          Length = 510

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 24/72 (33%), Positives = 39/72 (54%)
 Frame = -3

Query: 752 LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           +RN+K  D     +D+    W  I+  H+ N+M   +    +++ D+HAPV+  R K   
Sbjct: 428 IRNFKHFDQQKFVKDLLTQSWEQIVLCHDTNEMWAHWKDLFLNVLDRHAPVQSKRKKAFN 487

Query: 572 APWLTPDIKTLM 537
            PWLT +IK L+
Sbjct: 488 VPWLTREIKDLI 499


>SB_27446| Best HMM Match : Peptidase_C21 (HMM E-Value=2.7)
          Length = 246

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = -3

Query: 752 LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           +RN K  +     RD+    W  I+   + N M + +    +++ D+HAPV+  + K   
Sbjct: 123 IRNMKKFNQELFARDLLAQPWEQIVLCPDANKMWDFWRDLFLNVIDKHAPVQLKKKKAFS 182

Query: 572 APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR 393
            PW+T +I+ L+                    +YK+ RN+ N   R AK  ++   + ++
Sbjct: 183 HPWVTKEIRELIIHRDKAKRQAVVSKLSSDWEVYKSFRNKVNIALRQAKSNFYRNKVASQ 242


>SB_5806| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 418

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 24/98 (24%), Positives = 46/98 (46%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R +K  +  A R D+ + +W+ ++ +++ N M N+     +   ++HAP+   R++    
Sbjct: 155 RKFKNFNSDAFRADIASLNWNFLISYNDPNVMWNNRKEMFLHFVEKHAPLCTKRVRLSKP 214

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRN 456
           PW+  D+K LM           R    +   I+K  RN
Sbjct: 215 PWINSDLKKLMHQRDVFKIKAIRSKDVNDWKIFKKYRN 252



 Score = 37.5 bits (83), Expect = 0.012
 Identities = 19/68 (27%), Positives = 33/68 (48%)
 Frame = -3

Query: 617 DQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLC 438
           ++HAP+   R++   +PW+  D+K LM           R    +   I+K  RN  N   
Sbjct: 7   EKHAPLCTKRVRLSKSPWINSDLKKLMHQRDVFKIKAIRSKDVNDWKIFKKYRNFVNCQI 66

Query: 437 RDAKRLYF 414
           + AK++Y+
Sbjct: 67  KIAKQIYY 74


>SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20)
          Length = 838

 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 52/202 (25%), Positives = 86/202 (42%), Gaps = 16/202 (7%)
 Frame = -3

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRS 390
           PW++P IK LM           R   E  +  Y+ +RN   +  RD   +Y  + L   +
Sbjct: 9   PWVSPAIKRLMRKRNRAYKKAKRSSKEKDIRSYRRIRNYTTKCIRDMHNIYLSEVLGGLA 68

Query: 389 PAHTWRFLKSVGIGKTPVSSVK--DTDLCALNKHFSLPPVSLSDSSKTATL-LKISSL-- 225
           P  +     + G  K   S +K   ++   +   F    +  SDSSK   L ++  S+  
Sbjct: 69  PDPS---TPNPGGAKRAWSYLKLLRSESLGIPTLFQGDQICASDSSKAEALRVQYESVFT 125

Query: 224 --SVPRIPIFELSPV-SVADVRNSFFSI--------SSTAVGIDNVCSKMIALILPTVAP 78
              +  IP+   SP   VAD+  S   I         + A G D+V ++++      +AP
Sbjct: 126 QEDLTNIPVLGDSPYQEVADLTFSTNGIHKQLKNIQPNKASGPDSVPARILIEAAGELAP 185

Query: 77  ILTDIFNFSFTSSNFPDSWKPA 12
           +L  +F  S+ S + P +WK A
Sbjct: 186 LLAPLFQQSYDSGSLPAAWKDA 207


>SB_20167| Best HMM Match : RhoGEF (HMM E-Value=0.73)
          Length = 445

 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 52/202 (25%), Positives = 87/202 (43%), Gaps = 16/202 (7%)
 Frame = -3

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRS 390
           PW++P IK LM           R   E +L  Y+ +RN   +  RD   +Y  + L   +
Sbjct: 176 PWVSPAIKRLMRKRDRAYKKAKRLSKEKNLRSYRRIRNYTTKCIRDTHNIYLSEVLVGLA 235

Query: 389 PAHTWRFLKSVGIGKTPVSSVK--DTDLCALNKHFSLPPVSLSDSSKTATL-LKISSL-- 225
           P  +     + G  K   S +K   ++   +   F    +S SDSSK   L ++  S+  
Sbjct: 236 PDPS---TPNPGGAKRAWSYLKLLRSESLGIPTLFQGDQISASDSSKAEALRVQYESVFT 292

Query: 224 --SVPRIPIFELSPV-SVADVRNSFFSI--------SSTAVGIDNVCSKMIALILPTVAP 78
              +  IP+   SP   VAD+  +   I         + A   D+V ++++      +AP
Sbjct: 293 QEDLTNIPVLGDSPYQEVADLTFTTNGIHKQLKNLQPNKASSPDSVPARILIEAAGELAP 352

Query: 77  ILTDIFNFSFTSSNFPDSWKPA 12
           +L  +F  S+ S + P +WK A
Sbjct: 353 LLAPLFQQSYDSGSLPAAWKDA 374


>SB_3901| Best HMM Match : PkinA_anch (HMM E-Value=2.4)
          Length = 239

 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 51/202 (25%), Positives = 86/202 (42%), Gaps = 16/202 (7%)
 Frame = -3

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRS 390
           PW++P IK LM           R   E  +  Y+ +RN   +  RD   +Y  + L   +
Sbjct: 9   PWVSPAIKRLMRKRNRAYKKAKRSSKEKDIRSYRRIRNYTTKCIRDMHNIYLSEVLGGLA 68

Query: 389 PAHTWRFLKSVGIGKTPVSSVK--DTDLCALNKHFSLPPVSLSDSSKTATL-LKISSL-- 225
           P  +     + G  K   S +K   ++   +   F    +  SDSSK   L ++  S+  
Sbjct: 69  PDPS---TPNPGGAKRAWSYLKLLRSESLGIPTLFQGDQICASDSSKAEALRVQYESVFT 125

Query: 224 --SVPRIPIFELSPV-SVAD-------VRNSFFSIS-STAVGIDNVCSKMIALILPTVAP 78
              +  IP+   SP   VAD       +     +I  + A G D+V ++++      +AP
Sbjct: 126 QEDLTNIPVLGDSPYQEVADLTFFGNGIHKQLKNIQPNKASGPDSVAARILIEAAGELAP 185

Query: 77  ILTDIFNFSFTSSNFPDSWKPA 12
           +L  +F  S+ S + P +WK A
Sbjct: 186 LLAPLFRQSYDSGSLPAAWKDA 207


>SB_59383| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 709

 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 30/139 (21%), Positives = 65/139 (46%), Gaps = 4/139 (2%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVIS-LFDQHAPVRRVRIKHK- 576
           R+ K     +   D++   WS +  + ++ND ++ + YK+ + +   HAP++  RIK   
Sbjct: 268 RSRKNFCTESFMHDLSLVPWSTLDIYDDVNDALDQW-YKLFNDILTVHAPIKEHRIKRPL 326

Query: 575 PAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
              W   +I   +              T+ S + Y+  RN  + L R AK+ +++ +++N
Sbjct: 327 KLDWFNAEISAAIKARNCLHRIATSLKTDTSWSEYRRARNHVH-LIRKAKKTFYNDAIKN 385

Query: 395 --RSPAHTWRFLKSVGIGK 345
              +P + W+ ++ +   K
Sbjct: 386 NLENPKNLWKIIRKISPSK 404


>SB_59320| Best HMM Match : Exo_endo_phos (HMM E-Value=0.29)
          Length = 243

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 23/72 (31%), Positives = 39/72 (54%)
 Frame = -3

Query: 752 LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           +RN+K  D     +D+    W  I+  H+ N+M   +    +++ D+HAPV+  R +   
Sbjct: 161 IRNFKHFDQQKFVKDLLTQSWEQIVLCHDTNEMWAHWKDLFLNVLDRHAPVQSKRKRAFN 220

Query: 572 APWLTPDIKTLM 537
            PWLT +IK L+
Sbjct: 221 VPWLTREIKDLI 232


>SB_3604| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1319

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 28/113 (24%), Positives = 55/113 (48%), Gaps = 1/113 (0%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP- 573
            R  K +D+  L  D+ N+D  C    ++++++V+ ++  + +  D+HAP+++  I  +P 
Sbjct: 869  RKLKSVDIQTLNSDLINSDL-CTKTPNDLDELVSCYHNTLQAAVDKHAPLKQRTIVTRPR 927

Query: 572  APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYF 414
             PW T +I+              R     +   +K  RN  N L + A+R Y+
Sbjct: 928  VPWFTEEIRLAKRERRKAEKIWRRSRMVANFDTFKQRRNALNNLLKRARRDYY 980


>SB_49192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 188

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 34/139 (24%), Positives = 65/139 (46%), Gaps = 1/139 (0%)
 Frame = -3

Query: 617 DQHAPVRRVRIKHKPAPWLTP-DIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRL 441
           D+HAP++R ++   PAPWL   DI+ L            +  ++     ++  RN+   +
Sbjct: 15  DRHAPLKRTKVTRPPAPWLKELDIQKLQQDFRNMRTEARKEKSDSIWNYFREKRNQLKAM 74

Query: 440 CRDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDS 261
              AKR +++K+L +      WR +  + +   P     D D   LN HF+     ++ +
Sbjct: 75  IGKAKRNFYYKALSSVKAKDVWRVIHRI-LHPNPQPLRFDPD--ELNTHFASTAERVTGA 131

Query: 260 SKTATLLKISSLSVPRIPI 204
           + T+  + IS L +  +P+
Sbjct: 132 TLTSANV-ISDL-IQSLPV 148


>SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 1858

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 41/155 (26%), Positives = 74/155 (47%), Gaps = 8/155 (5%)
 Frame = -3

Query: 461  RNRCNRLCRDAKRLYFHKSLEN---RSPAHTWRFLKSV-GIGKTPVSSVKDTDLCALNKH 294
            + +  +LC+  K  Y    ++N   +     WR LK++  +GK       D ++ +L+ H
Sbjct: 1184 KKKFKKLCKRKKYQYRASGIKNLDFKDSKKLWRSLKNLFSVGKDKKQQECDLEIESLHSH 1243

Query: 293  FSLPPVSLSDSSKTATLLKISSLSVP--RIPIFEL-SPVSVADVRNSFFSISST-AVGID 126
            F        D +KT T    ++LS+P  R     L S + + +V+ +  ++ +  A G D
Sbjct: 1244 FM-------DLNKTTT----TNLSIPKCRDQTGPLDSEIRLEEVKLAIENLKNNKAPGHD 1292

Query: 125  NVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSW 21
            N+ ++++     T+ P LT +FN  F S  FP  W
Sbjct: 1293 NILNELLKYGKDTLLPYLTRLFNIIFRSGVFPQEW 1327


>SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1868

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 28/106 (26%), Positives = 48/106 (45%), Gaps = 5/106 (4%)
 Frame = -3

Query: 668  NINDMVNSFNYKVISLFDQHAPVRR---VRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRC 498
            ++ND +N     + SL D+HAP+R+    +IK +  PWLT  +   +             
Sbjct: 1139 DVNDSINKVISALQSLTDKHAPLRKRTNKQIKQQAKPWLTKAVLNSIKQRQKLFITHFLS 1198

Query: 497  PTEHSLAIYKALRNRCNRLCRDAKRLYFHK--SLENRSPAHTWRFL 366
                 +  YK   N+ NR+   AK++YF     L + +   TW+ +
Sbjct: 1199 NDSSKVRFYKNYNNKLNRVKEAAKKVYFENQFKLNSGNLKTTWKLI 1244


>SB_53821| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 269

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 49/235 (20%), Positives = 93/235 (39%), Gaps = 13/235 (5%)
 Frame = -3

Query: 677 EHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRC 498
           +H ++ +  +  +  +  + D+  P +  + K +  PW+ P +K LM           R 
Sbjct: 3   QHRSVEENWSDVSNCITDVMDRFIPYKMTKGK-RHLPWINPSVKRLMRKRDRAFIKAKRS 61

Query: 497 PTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN------RSPAH----TWRFLKSVGIG 348
             +  L  Y+ LRN  ++  R+    Y ++ +         S  H     W +LK +   
Sbjct: 62  GKDKDLNSYRNLRNSASKRIREEHNRYINEVMNGIASDSVTSRPHGVKRAWSYLKLLRSD 121

Query: 347 KTPVSSVK-DTDLCALNKHFSLPPVSLSDSSKT-ATLLKISSLSVPRIPIFELSPVSVAD 174
              + ++  D  +CA +   +    +  DS  T   L  +  L     P       S A 
Sbjct: 122 SLGIPTLFWDNHVCASDVAKAEALRAQYDSVFTHEDLTNVPVLDGSPFPDVTDIIFSAAG 181

Query: 173 VRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           ++     I +  A G D++ ++++      +API   +F  S+ S   P SWK A
Sbjct: 182 IQKQLQLIQTDKACGPDSIPARLLKEAACELAPIFASLFQQSYDSGKLPSSWKDA 236


>SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1)
          Length = 377

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 49/176 (27%), Positives = 75/176 (42%), Gaps = 26/176 (14%)
 Frame = -3

Query: 461 RNRCNRLCRDAKRLYFHKSLENRSPAHT-WRFLKSVGIGKTPVSSVKD-----------T 318
           RN   +  R+AKR +F+KS E  S A   WR+LK + IG+T   S              T
Sbjct: 2   RNNVFQSIREAKRNHFNKSFEQSSTAKEFWRYLK-IAIGQTSKPSPSQLRGNASNTPTIT 60

Query: 317 D----LCALNKHFSLPPVSLSDSS------KTATLLKISSLSVPRIPI---FELSPVSVA 177
           D      A N+ F     +  +S+       T+   K+      +IP    FE+  V   
Sbjct: 61  DPREIANAFNEFFVSVAATYRNSNVNMRTLSTSDFEKLKGFVDSKIPSGTKFEIPKVMQE 120

Query: 176 DVRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
            V+     + +  A G+D + ++++    P +A  LT I N S  +  FP  WK A
Sbjct: 121 FVQGYLLQLQTCKATGLDGISARLLRAAAPAIALSLTKIINQSIKTGRFPARWKEA 176


>SB_48398| Best HMM Match : BBE (HMM E-Value=4.1)
          Length = 243

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 30/116 (25%), Positives = 47/116 (40%), Gaps = 4/116 (3%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEH-HNINDMVNSFNYKVISLFDQHAPVR---RVRIK 582
           R+Y   D  A+  D+   +W     H  ++ND  +SF   V  + D+H P++   R  IK
Sbjct: 111 RDYSHYDESAVVHDMQAINWEHCFSHCKDVNDYFDSFYASVERIIDKHVPLKKLSRKEIK 170

Query: 581 HKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYF 414
               PW+T  IK  +                     +K  RN+  RL   +K  Y+
Sbjct: 171 FLSKPWITTGIKHSIAIKNKLYKQFLNTQNSFIHKQFKLYRNKLKRLLMASKEKYY 226


>SB_30943| Best HMM Match : Exo_endo_phos (HMM E-Value=4.7e-05)
          Length = 354

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 3/96 (3%)
 Frame = -3

Query: 668 NINDMVNSFNYKVISLFDQHAPVRR---VRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRC 498
           ++ND +N     + SL D+HAP+R+    +IK +  PWLT  +   +             
Sbjct: 251 DVNDSINKVISALQSLTDKHAPLRKRTNKQIKQQAKPWLTKAVLNSIKQRQILFLTHFLS 310

Query: 497 PTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRS 390
                +  YK   N+ NR+   AK++YF    +  S
Sbjct: 311 NDSSKVRFYKIYNNKLNRVKEAAKKVYFENQFKLNS 346


>SB_6691| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0031)
          Length = 753

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 49/235 (20%), Positives = 93/235 (39%), Gaps = 13/235 (5%)
 Frame = -3

Query: 677  EHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRC 498
            +H ++ +  +  +  +  + D+  P +  + K +  PW+ P +K LM           R 
Sbjct: 487  QHRSVEENWSDVSNCITDIMDRFIPHKMTKGK-RHLPWINPSVKRLMRKRDRAFKKAKRS 545

Query: 497  PTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN------RSPAH----TWRFLKSVGIG 348
              +  L  Y+ LRN  ++  R+    Y ++ +         S  H     W +LK +   
Sbjct: 546  GKDKDLNSYRNLRNSASKRIREEHNRYINEVMNGIASDSVTSRPHGVKRAWSYLKLLRSD 605

Query: 347  KTPVSSVK-DTDLCALNKHFSLPPVSLSDSSKT-ATLLKISSLSVPRIPIFELSPVSVAD 174
               + ++  D  +CA +   +    +  DS  T   L  +  L     P       S A 
Sbjct: 606  SLGIPTLFWDNHVCASDVAKAEALRAQYDSVFTHEDLTNVPVLDGSPFPDVTDIIFSAAG 665

Query: 173  VRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
            ++     I +  A G D++ ++++      +API   +F  S+ S   P SWK A
Sbjct: 666  IQKQLQLIQTDKACGPDSIPARLLKEAACELAPIFASLFQQSYDSGKLPSSWKDA 720


>SB_32796| Best HMM Match : MSG (HMM E-Value=2.7)
          Length = 270

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 39/153 (25%), Positives = 70/153 (45%), Gaps = 6/153 (3%)
 Frame = -3

Query: 461 RNRCNRLCRDAKRLYFHKSLEN---RSPAHTWRFLKSV-GIGKTPVSSVKDTDLCALNKH 294
           + +  +LC+  K  Y    ++N   +     WR LK++  +GK       D ++ +L+ H
Sbjct: 97  KKKFKKLCKRKKYQYRASGIKNLDFKDSKKLWRSLKNLFSVGKDKKQQECDLEIESLHSH 156

Query: 293 FSLPPVSLSDSSKTATL-LKISSLSVPRIPIFELSPVSVADVRNSFFSISST-AVGIDNV 120
           F        D +KT T  L IS       P+   S + + +V+ +  ++ +  A G DN+
Sbjct: 157 FM-------DLNKTTTTNLSISKCRDQTGPLD--SEIRLEEVKLAIENLKNNKAPGHDNI 207

Query: 119 CSKMIALILPTVAPILTDIFNFSFTSSNFPDSW 21
            ++++     T+ P LT +FN    S  FP  W
Sbjct: 208 LNELLKYGKDTLLPYLTRLFNIILRSGVFPQEW 240


>SB_30907| Best HMM Match : THAP (HMM E-Value=0.0033)
          Length = 892

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 44/173 (25%), Positives = 81/173 (46%), Gaps = 18/173 (10%)
 Frame = -3

Query: 476 IYKALRNRCNRLCRDAKRLYFHKSL-ENRSPA-HTWRFLKSVGIGKTPVSSVKD------ 321
           I+K  RN  N   + AK++Y+  +  EN     +TW+ +  + + KT  S++K+      
Sbjct: 340 IFKKYRNFVNCQIKIAKQIYYDNAFRENEGNIRNTWKVINELTLRKTNNSTIKEVKLDDD 399

Query: 320 ---TDLCALNKHFSLPPVSLSDS--SKTATLLKISSLS----VPRIPIFELSPVSVADVR 168
              TD  +L++ F+L   ++  +  +  A +  +S L+          F L+  S + V 
Sbjct: 400 HSITDSLSLSEAFNLHFATIGPNLANNIAAIGDLSHLNFLTRAANNNYFNLTVTSQSKVL 459

Query: 167 NSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
                ++ T A G+D + ++++      +A  L  IFN S  S  FP+ WK A
Sbjct: 460 ALLRKLTKTKATGLDRIPARILRECSDLIAVSLCLIFNHSIISGIFPEEWKSA 512


>SB_58999| Best HMM Match : Exo_endo_phos (HMM E-Value=2.6)
          Length = 509

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 53/199 (26%), Positives = 84/199 (42%), Gaps = 17/199 (8%)
 Frame = -3

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRS 390
           PW++P IK LM           R   E  L +Y+ +RN   +  RD   +Y  K L   +
Sbjct: 210 PWVSPAIKRLMRKRDRAYKNAKRSSKEKDLRLYRRIRNYTTKCIRDTHNIYLSKVLGGLA 269

Query: 389 PAHTWRFLKSVGIGKTPVSSVK--DTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSV- 219
           P  +     + G  K   S +K   ++   +   F    +  SDSSK A  L + + SV 
Sbjct: 270 PDPS---TPNPGGAKGAWSYLKLLRSESLGIPTLFQGDQICASDSSK-AEALHVQNDSVF 325

Query: 218 -----PRIPIFELSPV-SVADVRNSFFSI--------SSTAVGIDNVCSKMIALILPTVA 81
                  IP+   SP   VAD+  +   I         + A G D+V ++ +      +A
Sbjct: 326 TKEDLTNIPVLGDSPYQEVADLTFTTNGIHKQLKNIQPNKASGPDSVPARFLIEAAGELA 385

Query: 80  PILTDIFNFSFTSSNFPDS 24
           P+L  +F  S+ S + PD+
Sbjct: 386 PLLVPLFQQSYDSGSLPDA 404


>SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1855

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 49/235 (20%), Positives = 93/235 (39%), Gaps = 13/235 (5%)
 Frame = -3

Query: 677  EHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRC 498
            +H ++ +  +  +  +  + D+  P +  + K +  PW+ P +K LM           R 
Sbjct: 1309 QHRSVEENWSDVSNCITDVMDRFIPHKMTKGK-RHLPWINPSVKRLMRKRDRAFKKAKRS 1367

Query: 497  PTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN------RSPAH----TWRFLKSVGIG 348
              +  L  Y+ LRN  ++  R+    Y ++ +         S  H     W +LK +   
Sbjct: 1368 GKDKDLNSYRNLRNSASKRIREEHNRYINEVMNGIASDSVTSRPHGVKRAWSYLKLLRSD 1427

Query: 347  KTPVSSVK-DTDLCALNKHFSLPPVSLSDSSKT-ATLLKISSLSVPRIPIFELSPVSVAD 174
               + ++  D  +CA +   +    +  DS  T   L  +  L     P       S A 
Sbjct: 1428 SLGIPTLFWDNHVCASDVAKAEALRAQYDSVFTHEDLTNVPVLDGSPFPDVTDIIFSAAG 1487

Query: 173  VRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
            ++     I +  A G D++ ++++      +API   +F  S+ S   P SWK A
Sbjct: 1488 IQKQLQLIQTDKACGPDSIPARLLKEAACELAPIFASLFQQSYDSGKLPSSWKDA 1542



 Score = 37.5 bits (83), Expect = 0.012
 Identities = 20/72 (27%), Positives = 37/72 (51%)
 Frame = -3

Query: 752 LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           +RN K  +     RD+    W  I+   + N M + +    +++ D+HAPV+  + K   
Sbjct: 427 IRNMKKFNQELFARDLLAQPWEQIVLCPDANKMWDFWRDLFLNVLDKHAPVQLKKKKAFS 486

Query: 572 APWLTPDIKTLM 537
            PW+T +I+ L+
Sbjct: 487 DPWVTKEIRELI 498


>SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3142

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 56/255 (21%), Positives = 102/255 (40%), Gaps = 11/255 (4%)
 Frame = -3

Query: 743  YKGIDLGALRRDVNN--TDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
            Y   D+ ALR D+ +  T++     H+N+ +  +SF   +I   D+H P +  R +    
Sbjct: 579  YHKADMEALREDILSRATEFLDQCTHNNLEENWSSFKNILIDAIDRHVPWKMTRAR-PSL 637

Query: 569  PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLA--IYKALRNRCNRLCRDAKRLYFHKSLE- 399
            PW++  IK  M           R   + S A   Y+  RN+   L + + R Y +  +  
Sbjct: 638  PWISRSIKRQMRKRDRLFKKAKRSCDKLSAAWVHYRHQRNKVVNLVKASHRNYLNSVIGG 697

Query: 398  --NRSPAHTWRFLKSVGIGKTPVSSVKDTD---LCALNKHFSLPPVSLSDSSKTATLLKI 234
              + +P   W ++K        + +++  D   +   +K   L     S  ++   +L  
Sbjct: 698  SLHENPKRFWSYVKQARCENIGIPTLRSGDSLYISDSDKAEVLNTFFQSVFTQDNGILPN 757

Query: 233  SSLSVPRIPIFELSPVSVADVRNSFFSI-SSTAVGIDNVCSKMIALILPTVAPILTDIFN 57
            S+ SV  I            V      + SS + G D +  + +  +   V+ +LT IF 
Sbjct: 758  STPSVSNIKDISDMEFFQPGVEKLLAQLDSSKSPGPDGISPRCLKELSKEVSGMLTVIFQ 817

Query: 56   FSFTSSNFPDSWKPA 12
             S+     P+ W  A
Sbjct: 818  QSYNIGALPNDWLTA 832


>SB_25416| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 280

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 20/62 (32%), Positives = 37/62 (59%)
 Frame = -3

Query: 722 ALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKT 543
           AL + + + DWS + E  +I+D+ N+F   +  L D+  P++ + +  +  PWLTP +K 
Sbjct: 64  ALYKRLVDFDWSPLRELSSIDDIANTFQSTLHLLMDECLPLKSITMSSRDPPWLTPLVKV 123

Query: 542 LM 537
           L+
Sbjct: 124 LL 125


>SB_25856| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.4)
          Length = 296

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 24/115 (20%), Positives = 50/115 (43%), Gaps = 3/115 (2%)
 Frame = -3

Query: 692 WSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXX 513
           W  +LE     +   +F+  +    D + P++  R+     PW+TPD K L+        
Sbjct: 147 WDHVLELDTCQEKWTTFHRTISEAVDLYLPLKSRRVHETDKPWVTPDTKRLISKRQKYLN 206

Query: 512 XXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFH---KSLENRSPAHTWRFLKSV 357
                P +     +K++RN+     ++ KR+++      L+  +P   W+ +K +
Sbjct: 207 KFGEDPAQ-----FKSMRNKVQSRIKECKRIFYKLKVAKLKESNPIKWWKEIKKL 256


>SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25)
          Length = 867

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 52/243 (21%), Positives = 100/243 (41%), Gaps = 10/243 (4%)
 Frame = -3

Query: 707  VNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXX 528
            + +  W  +    +  +    F  K++   D+  P+R VR+     PWLT  IK  +   
Sbjct: 369  ITSYSWDELYNLTSCREKFEWFYRKIMEAIDKFLPMRSVRMHATDKPWLTTAIKIAISKR 428

Query: 527  XXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFH---KSLENRSPAHTWRFLKSV 357
                        E  L  +K+ RN+  RL +  K  +F    KSL++ + A  W+ +K++
Sbjct: 429  QRYLSKYG---KESDL--FKSWRNKVQRLVKQCKGSFFDTKVKSLKDTNTARWWKEVKNL 483

Query: 356  -GIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELS-PVS 183
             GI  T     +     + +       ++    S T+  + +++  +  IP+ E   P  
Sbjct: 484  SGISSTEGQWFRQLINESESITSLCERINTFFCSLTSDFVPLTTDDILGIPVDESEIPTD 543

Query: 182  V-ADVRNSFFSISS----TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
            +    R +  ++ S     A G D + + ++      +AP++ +I+N S      P   K
Sbjct: 544  LYVSSREAGIALQSIKLRKAGGPDGIPNIILKTFSFELAPVIAEIYNASLREGYLPPLLK 603

Query: 17   PAA 9
             AA
Sbjct: 604  SAA 606


>SB_1713| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 185

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 21/67 (31%), Positives = 33/67 (49%)
 Frame = -3

Query: 752 LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           +R  K +D     +D      S I    + +DMV  FN       ++HAP+RR+++   P
Sbjct: 82  IRLEKNLDANEFVKDCATLPLSVIYGLDSPDDMVQGFNTLFTECIERHAPLRRIKVTRPP 141

Query: 572 APWLTPD 552
           APW+  D
Sbjct: 142 APWMDCD 148


>SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1462

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 57/258 (22%), Positives = 102/258 (39%), Gaps = 15/258 (5%)
 Frame = -3

Query: 746  NYKGIDLGALRRDVNNTDWSCILEHHNINDMV-NSFNYKVISLFDQHAPVRRVRIKHKPA 570
            N++ ID  ALR ++  +        +N  D+  + +   +  + D+H P  R R  +   
Sbjct: 314  NFRNIDFTALRDEIRESALLVECARNNDIDIAWDGWCRVLFEILDKHVPKIRSR-PNSTL 372

Query: 569  PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFH---KSLE 399
            PW   ++  L+           R   +     Y  LR  C  L     +LY     +SL+
Sbjct: 373  PWFDAEVINLLKKKETARRKAKRTGHQSHQLKYALLRRECKTLIAAKHKLYVEGLSQSLK 432

Query: 398  NRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKT--ATLLK---- 237
            + +P   W + ++    KT  +S+ DT     +K +S P       ++   +T  +    
Sbjct: 433  S-NPKKFWSYFRA----KTKSNSIPDTVTHNGSKFYS-PDEKAEALNRFFFSTFTRDDDR 486

Query: 236  ----ISSLSVPRIPIFELSPVSVADVRNSFFSISST-AVGIDNVCSKMIALILPTVAPIL 72
                    S     + +   +SV +VR +  S+    A G DN+ S ++ +    +AP L
Sbjct: 487  FPEAYHDYSSGNSSVLQAIQLSVEEVRAALASVDPRKARGPDNIPSAVLKICANELAPSL 546

Query: 71   TDIFNFSFTSSNFPDSWK 18
              +FN S      P  WK
Sbjct: 547  CGLFNKSLELGKLPVEWK 564


>SB_8718| Best HMM Match : Lipase_GDSL (HMM E-Value=0.023)
          Length = 836

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 40/155 (25%), Positives = 73/155 (47%), Gaps = 8/155 (5%)
 Frame = -3

Query: 461 RNRCNRLCRDAKRLYFHKSLEN---RSPAHTWRFLKSV-GIGKTPVSSVKDTDLCALNKH 294
           + +  +LC+  K  Y    ++N   +     WR LK++  +GK       D ++ +L+ H
Sbjct: 541 KKKFKKLCKRKKYQYRASGIKNLDFKDSKKLWRSLKNLFSVGKDKKQQECDLEIESLHSH 600

Query: 293 FSLPPVSLSDSSKTATLLKISSLSVP--RIPIFEL-SPVSVADVRNSFFSISST-AVGID 126
           F        D +KT T    ++LS+P  R     L S + + +V+ +  ++ +  A G D
Sbjct: 601 FM-------DLNKTTT----TNLSIPKCRDQTGPLDSEIRLEEVKLAIENLKNNKAPGHD 649

Query: 125 NVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSW 21
           N+ ++++     T+ P LT +FN    S  FP  W
Sbjct: 650 NILNELLKYGKDTLLPYLTRLFNIILRSGVFPQEW 684


>SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1317

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 40/155 (25%), Positives = 73/155 (47%), Gaps = 8/155 (5%)
 Frame = -3

Query: 461  RNRCNRLCRDAKRLYFHKSLEN---RSPAHTWRFLKSV-GIGKTPVSSVKDTDLCALNKH 294
            + +  +LC+  K  Y    ++N   +     WR LK++  +GK       D ++ +L+ H
Sbjct: 904  KKKFKKLCKRKKYQYRASGIKNLDFKDSKKLWRSLKNLFSVGKDKKQQECDLEIESLHSH 963

Query: 293  FSLPPVSLSDSSKTATLLKISSLSVP--RIPIFEL-SPVSVADVRNSFFSISST-AVGID 126
            F        D +KT T    ++LS+P  R     L S + + +V+ +  ++ +  A G D
Sbjct: 964  FM-------DLNKTTT----TNLSIPKCRDQTGPLDSEIRLEEVKLAIENLKNNKAPGHD 1012

Query: 125  NVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSW 21
            N+ ++++     T+ P LT +FN    S  FP  W
Sbjct: 1013 NILNELLKYGKDTLLPYLTRLFNIILRSGVFPQEW 1047


>SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1019

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 53/236 (22%), Positives = 99/236 (41%), Gaps = 13/236 (5%)
 Frame = -3

Query: 677  EHHNINDMVNSFNY---KVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXX 507
            E HN+      F +   K++   D+  P+R VR+     PWLT  IK  +          
Sbjct: 376  ELHNLTSCREKFEWFYRKIMEAIDKFLPMRSVRMHATDKPWLTTAIKIAISKRQRYLSKY 435

Query: 506  XRCPTEHSLAIYKALRNRCNRLCRDAKRLYFH---KSLENRSPAHTWRFLKSV-GIGKTP 339
                 E  L  +K+ RN+  RL +  K  +F    KSL++ + +  W+ +K++ GI  T 
Sbjct: 436  G---KESDL--FKSWRNKVQRLVKQCKGSFFDTKVKSLKDTNTSRWWKEVKNLSGISSTE 490

Query: 338  VSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELS-PVSV-ADVRN 165
                +     + +       ++    S T+  +  ++  +  IP+ E + P  +    R 
Sbjct: 491  GQWFRQLINESESITSLCERINTFFCSLTSDFVPFTTDDILGIPVDESAIPTDLYVSSRE 550

Query: 164  SFFSISS----TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPAA 9
            +  ++ S     A G D + + ++      +AP++ +I+N S      P   K AA
Sbjct: 551  AGIALQSIKLRKAGGPDGIPNIILKTFSFELAPVIAEIYNASLREGYLPPLLKSAA 606


>SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12)
          Length = 642

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 54/222 (24%), Positives = 89/222 (40%), Gaps = 9/222 (4%)
 Frame = -3

Query: 650 NSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIY 471
           N+F   V +  D   P +   I    APW+TP +K+++             P       +
Sbjct: 18  NTFIEVVSTGLDIILPKKEYHICAADAPWMTPGLKSIILKRQEAFKNHG--PESVQFKFF 75

Query: 470 KALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHF 291
           + + NR  ++CR        K L+  +P   W  +K +   K  V++   T    +    
Sbjct: 76  RNMVNRERKVCRSRFYDSKVKQLKGENPKKWWDEVKRLCGAK--VTNGDLTTQINIENFS 133

Query: 290 SLPPVSLSDSSKTATL--LKISSLSVP--RIPIFELSPVSVADVRNSFFSISST-----A 138
            LP    ++   +A L  L++  L+ P  R P+ E  PV ++   +    + S      A
Sbjct: 134 ELPMQDQANRINSAFLEPLEVYRLNEPLERFPL-EDEPVFLSVTEDRVQKVLSKLHPRKA 192

Query: 137 VGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
            G DNV S ++      +A  +T I N SF     P  WK A
Sbjct: 193 SGPDNVPSWLLKEFSDIMAQPITQILNASFKDQRLPPIWKMA 234


>SB_21418| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 887

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 46/225 (20%), Positives = 89/225 (39%), Gaps = 10/225 (4%)
 Frame = -3

Query: 662  NDMVNSFNYKVISLFDQHAPVRRVRIKHKP-APWLTPDIKTLMXXXXXXXXXXXRCPTEH 486
            N + + +N  +    ++HAPVR   +  +P +PW    ++ L                E 
Sbjct: 383  NVLCDQYNTVLNHFIEKHAPVRTFSVTLRPYSPWYDDSLRLLKRQKRKAERRYVSSRLEI 442

Query: 485  SLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSV-GIGKTPV-SSVKDTDL 312
               +Y+      +     AKR ++   +   +    +R +  +  +   P+  S +    
Sbjct: 443  HRQVYEEKCRAYSTALNVAKRNFYKDQISGSNQTQLFRLIDGLFRVKPVPLLPSYESPQA 502

Query: 311  CALN--KHFSLPPVSLSDSSKTATLLKISSLSVPRIP-----IFELSPVSVADVRNSFFS 153
             A +    F+     L D+ +++ LL +     P  P       E S VSV+ +R+    
Sbjct: 503  LAEDFILFFTTKIQHLKDNLRSSPLLTMEMSVTPAQPQCVASFPEFSAVSVSYIRDILQQ 562

Query: 152  ISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
                +  +D V + ++   +  +AP +T I N S +S  FP S K
Sbjct: 563  SKPKSCILDPVPTSVLKQSIDVIAPAITSIVNASLSSGVFPTSLK 607


>SB_58944| Best HMM Match : fn3 (HMM E-Value=0.88)
          Length = 697

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 64/267 (23%), Positives = 112/267 (41%), Gaps = 22/267 (8%)
 Frame = -3

Query: 746 NYKGIDLGALRRDVNNTDWSCIL-EHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           NY   D   LR  ++  + +    E+ +I+    ++    ++    H P +++R ++ P 
Sbjct: 63  NYTKADFDGLRASLSALELTMSSNENSDIDTDWQNWKDLFLAAVADHVPSKKLRGRN-PV 121

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAI-YKALRNRCNRLCRDAKRLY------FH 411
           PW+   I  L+           + P + SL   +KALR       +  +R Y      F 
Sbjct: 122 PWMNGTILDLIKKKETTRRRLKKTPAKASLREKFKALRESRENFFQSLERDYKNNTKRFW 181

Query: 410 KSLENRS-----PAHTWRFLKSVGIGK---TPV-SSVKDTDLCA--LNKHFSLPPVSLSD 264
             L+ +S     P+H      +   G    TP+ ++  D +  A   NK+F+   V L D
Sbjct: 182 SVLKQKSKSRGLPSHVSMATVNPPTGSQDPTPLRTTADDPEAIANLFNKYFA--SVFLKD 239

Query: 263 SSKTATLLKISSLSVPRIPIFELSPVS--VADVRNSFFSI-SSTAVGIDNVCSKMIALIL 93
           S +       +      +P+ ELS +S  + D+ +    + +S A G DN+  +++    
Sbjct: 240 SLQDLN----TDPEHCALPVPELSNISFDINDILSVIRGLDASKASGPDNIPVRLLKETA 295

Query: 92  PTVAPILTDIFNFSFTSSNFPDSWKPA 12
             +AP L  IFN S     FP  WK A
Sbjct: 296 AVIAPSLCQIFNKSIKLGKFPSEWKIA 322


>SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 822

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 50/254 (19%), Positives = 101/254 (39%), Gaps = 9/254 (3%)
 Frame = -3

Query: 746 NYKGIDLGALRRDVNNTDWS-CILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           N+K  D   L   + N  W  C  +  NI+  + ++    ++  ++H P  + R      
Sbjct: 222 NFKRADWTGLNESLKNIPWDLCFSQSDNIDSSLANWTDLFLAAVNEHIPKSKPR-NVSDY 280

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK--SLEN 396
           PW+  ++++L+           +  +  +   Y  LR    ++    K+ +  K  S+ +
Sbjct: 281 PWIDHELRSLLKKKDAQRKKANKTGSLAAERKYNELRRAAKQMLSKKKKEHAEKLESVIS 340

Query: 395 RSPAHTWRFLKSVGIGKTPVSSVKDTD-LCALNKHFS--LPPVSLSDSSKTATLLKISSL 225
            +P   W ++KS    K   +  +D        K+ +  L        S +A+   +S+ 
Sbjct: 341 DNPKRFWGYVKSCTSNKPSPNFFRDGHAFVTYTKNMANLLNRYFNYIFSPSASEEFVSAQ 400

Query: 224 SVPRIPIFELSPV--SVADVRNSFFSISS-TAVGIDNVCSKMIALILPTVAPILTDIFNF 54
              R P+  L  +  +V +V +   ++    A G D +   ++      +AP L  +FN 
Sbjct: 401 PTNREPVLGLGSIQLTVPEVLDVLRNLDPHKACGTDQIPGILLKNTAHQIAPSLCRLFNL 460

Query: 53  SFTSSNFPDSWKPA 12
           S +    P  WK A
Sbjct: 461 SLSLGFVPALWKDA 474


>SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2396

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 18/61 (29%), Positives = 33/61 (54%)
 Frame = -3

Query: 722  ALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKT 543
            AL  +   TDW  + +  N+N  V     ++ +L D+H P+R V++  +   W+ P +K+
Sbjct: 1114 ALYMEFAETDWGDVTKATNVNVAVGGLEQRIRTLMDKHMPLRSVQMSTQDPAWMMPLVKS 1173

Query: 542  L 540
            L
Sbjct: 1174 L 1174


>SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25)
          Length = 1486

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 58/268 (21%), Positives = 103/268 (38%), Gaps = 22/268 (8%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP- 573
            R  K ID  A   D++ +D  C         +V+ +N  +  L D+HAP++   +  +P 
Sbjct: 277  RKVKAIDTTAFMSDLSASDL-CQDPPSETVQLVDCYNKTLAGLLDRHAPLKTKTVTVRPQ 335

Query: 572  APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLY---FHKSL 402
             PW + +I+                 +   LA +K  +N    L ++AK  +   F    
Sbjct: 336  VPWYSEEIREAKRVRRRAERKWRITRSADDLASFKRHKNHVTYLLKEAKSAFLTDFVSQN 395

Query: 401  ENRSPAHTWRFLKSVGIGKTPV--SSVKDTDLCA--LNKHFSLPPVSLSD---------- 264
             +      +R +K + + K  +  S   D    A  + K+F      L D          
Sbjct: 396  SDNQGKFQFRAVKDLLVKKNSLCFSDYADKSALANDIGKYFVEKINRLRDELDKGCGASE 455

Query: 263  ---SSKTATLLKISSLS-VPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALI 96
               S        + ++S VPR+  F+L  ++  DV     +   T+  +D + +      
Sbjct: 456  NVQSGDLVNHCTVETVSLVPRMEAFKL--LTEEDVCMLIKNSKCTSCCLDPIPTPFSKSC 513

Query: 95   LPTVAPILTDIFNFSFTSSNFPDSWKPA 12
               +  ++T + N S  S  FPD WK A
Sbjct: 514  SEPLVSVITKLINNSLESGIFPDCWKEA 541


>SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29)
          Length = 605

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 49/226 (21%), Positives = 91/226 (40%), Gaps = 11/226 (4%)
 Frame = -3

Query: 662 NDMVNSFNYKVISLFDQHAPVRRVRIKHKP-APWLTPDIKTLMXXXXXXXXXXXRCPTEH 486
           N + + +N  +    ++HAPVR   +  +P +PW    ++ L                E 
Sbjct: 35  NVLCDQYNTVLNHFIEKHAPVRTFSVTLRPYSPWYDDSLRLLKRQKRKAERRYVSSRLEI 94

Query: 485 SLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDL-C 309
              +Y+      +     AKR ++   +   +    +R +  +   K PV  +   +   
Sbjct: 95  HRQMYEEKCRAYSTALNVAKRNFYKDQISGSNQTQLFRLIDGLFRVK-PVPLLPSYESPT 153

Query: 308 ALNKHFSLPPVS----LSDSSKTATLLKISSLSVPRIP-----IFELSPVSVADVRNSFF 156
           AL + F L   +    L D+ +++ LL +     P  P       E S VSV+ +R+   
Sbjct: 154 ALAEDFILFFTTKIQHLKDNLRSSPLLTMEMSVTPAQPQCVASFPEFSAVSVSYIRDILQ 213

Query: 155 SISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
                +  +D V + ++   +  +AP +T I N S +S  FP S K
Sbjct: 214 QSKPKSCILDPVPTSVLKQSIDVIAPAITSIVNASLSSGVFPTSLK 259


>SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1821

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 69/276 (25%), Positives = 117/276 (42%), Gaps = 31/276 (11%)
 Frame = -3

Query: 746 NYKGIDLGALRRDVNNTDWSCIL-EHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           NY   D   LR  ++  + +    E+ +I+    ++    ++    H P +++R ++ P 
Sbjct: 158 NYTKADFDGLRASLSALELTMSSNENSDIDTDWQNWKDLFLAAVADHVPSKKLRGRN-PV 216

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAI-YKALRNRCNRLCRDAKRLYFHKSLENR 393
           PW+   I  L+           + P + SL   +KALR    +  R+++  +F +SLE  
Sbjct: 217 PWMNGTILDLIKKKETTRRRLKKTPAKASLREKFKALRAEVKQALRESRENFF-QSLERD 275

Query: 392 SPAHTWRFL-------KSVGIGK----------------TPV-SSVKDTDLCA--LNKHF 291
              +T RF        KS G+                  TP+ ++  D +  A   NK+F
Sbjct: 276 YKNNTKRFWSVLKQKSKSRGLPSQVSMATVNPPTGSQDPTPLRTTADDPEAIANLFNKYF 335

Query: 290 SLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVS--VADVRNSFFSI-SSTAVGIDNV 120
           +   V L DS +   L        P +P  ELS +S  + D+ +    + +S A G DN+
Sbjct: 336 A--SVFLKDSLQD--LNTDPEHCAPPVP--ELSNISFDINDILSVIRGLDASKASGPDNI 389

Query: 119 CSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
             +++      +AP L  IFN S     FP  WK A
Sbjct: 390 PVRLLKETAAVIAPSLCQIFNKSIKLGKFPSEWKIA 425


>SB_14165| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1837

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 42/156 (26%), Positives = 67/156 (42%), Gaps = 12/156 (7%)
 Frame = -3

Query: 593  VRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYF 414
            VR+ +   PW+TP IKTL+           + P E     + + RN+     +++KR Y+
Sbjct: 1290 VRLHNTDKPWITPRIKTLISRRQSALAAHGKDPHE-----FHSWRNQVQTAIKNSKRAYY 1344

Query: 413  H---KSLENRSPAHTWRFLKSVGIGKTP--------VSSVKDTDLCALNKHFSLPPVSLS 267
            +   K L+       W  +KS+    T         +     T    L +  +   V L+
Sbjct: 1345 NSKVKGLKETRAEKWWSNVKSLSGSSTSRDQWYCQLIDGSNITSTLDLREKINQFFVGLT 1404

Query: 266  DSSKTATLLKISSLSVPRIP-IFELSPVSVADVRNS 162
                  T   +SS+ V + P  FEL+PV VAD+ NS
Sbjct: 1405 SDFSPLTPADVSSIQVKKSPWTFELAPV-VADIYNS 1439


>SB_56872| Best HMM Match : RVT_1 (HMM E-Value=2.7e-30)
          Length = 575

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 28/150 (18%), Positives = 64/150 (42%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+ K +D+     D+++  W  +     ++D  + +     ++ ++H P +++R +    
Sbjct: 26  RSTKSLDVEKFNEDLSSAPWHVMETFDTMDDKYHYWETLFNTIVEKHMPTKKMRFRKADV 85

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRS 390
           P++TP+ K  +              TE +  + +  RN+     R A + Y+ +  ++  
Sbjct: 86  PYMTPEWKQAIKMKRKFAKQYAHSKTEENWELKRKWRNKATNCRRKAIKEYWQQKADDLK 145

Query: 389 PAHTWRFLKSVGIGKTPVSSVKDTDLCALN 300
            A   +F K+      P  S K   +C +N
Sbjct: 146 -AKPSKFYKTF----RPFLSDKKQLVCEIN 170


>SB_25574| Best HMM Match : Gp-FAR-1 (HMM E-Value=1.9)
          Length = 324

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 28/150 (18%), Positives = 64/150 (42%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+ K +D+     D+++  W  +     ++D  + +     ++ ++H P +++R +    
Sbjct: 26  RSTKSLDVEKFNEDLSSAPWHVMETFDTMDDKYHYWETLFNTIVEKHMPTKKMRFRKADV 85

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRS 390
           P++TP+ K  +              TE +  + +  RN+     R A + Y+ +  ++  
Sbjct: 86  PYMTPEWKQAIKMKRKFAKQYAHSKTEENWELKRKWRNKATNCRRKAIKEYWQQKADDLK 145

Query: 389 PAHTWRFLKSVGIGKTPVSSVKDTDLCALN 300
            A   +F K+      P  S K   +C +N
Sbjct: 146 -AKPSKFYKTF----RPFLSDKKQLVCEIN 170


>SB_10446| Best HMM Match : Exo_endo_phos (HMM E-Value=6.6e-20)
          Length = 1285

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 46/225 (20%), Positives = 89/225 (39%), Gaps = 10/225 (4%)
 Frame = -3

Query: 662  NDMVNSFNYKVISLFDQHAPVRRVRIKHKP-APWLTPDIKTLMXXXXXXXXXXXRCPTEH 486
            N + + +N  +    ++HAPVR   +  +P +PW    ++ L                E 
Sbjct: 962  NVLCDQYNTVLNHFIEKHAPVRTFSVTLRPYSPWYDDSLRLLKRQKRKAERRYVSSRLEI 1021

Query: 485  SLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSV-GIGKTPV-SSVKDTDL 312
               +Y+      +     AKR ++   +   +    +R +  +  +   P+  S +    
Sbjct: 1022 HRQMYEEKCRAYSTALNVAKRNFYKDQISGSNQTQLFRLIDGLFRVKPVPLLPSYESPQA 1081

Query: 311  CALN--KHFSLPPVSLSDSSKTATLLKISSLSVPRIP-----IFELSPVSVADVRNSFFS 153
             A +    F+     L D+ +++ LL +     P  P       E S VSV+ +R+    
Sbjct: 1082 LAEDFILFFTTKIQHLKDNLRSSPLLTMEMSVTPAQPQCVASFPEFSAVSVSYIRDILQQ 1141

Query: 152  ISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
                +  +D V + ++   +  +AP +T I N S +S  FP S K
Sbjct: 1142 SKPKSCILDPVPTSVLKQSIDVIAPAITPIVNASLSSGVFPTSLK 1186


>SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 789

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 1/71 (1%)
 Frame = -3

Query: 221 VPRIPIFELSPVSVADVRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFT 45
           +P    FE+  +    V+     + +  A G+D + ++++    PT+AP LT I N S  
Sbjct: 434 IPSGTKFEIPKIMQEFVQGYLLQLQTCKATGLDGISARLLRAAAPTIAPSLTKIINQSIK 493

Query: 44  SSNFPDSWKPA 12
           +  FP  WK A
Sbjct: 494 TGRFPARWKEA 504


>SB_36163| Best HMM Match : RVT_1 (HMM E-Value=4.2e-11)
          Length = 258

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 17/42 (40%), Positives = 26/42 (61%)
 Frame = -3

Query: 137 VGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           +GID   +K++ L  P +AP ++ + N+S  SS FP  WK A
Sbjct: 1   MGIDKFSAKILKLAAPIIAPSISKLMNYSIESSEFPKRWKTA 42


>SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23)
          Length = 407

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 1/71 (1%)
 Frame = -3

Query: 221 VPRIPIFELSPVSVADVRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFT 45
           +P    FE+  +    V+     + +  A G+D + ++++    PT+AP LT I N S  
Sbjct: 20  IPSGTKFEIPKIMQEFVQGYLLQLQTCKATGLDGISARLLRAAAPTIAPSLTKIINQSIK 79

Query: 44  SSNFPDSWKPA 12
           +  FP  WK A
Sbjct: 80  TGRFPARWKEA 90


>SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07)
          Length = 1054

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 20/45 (44%), Positives = 26/45 (57%)
 Frame = -3

Query: 146 STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           S A GID V  KM+    P +A  L+ IFN S  + +FP+ WK A
Sbjct: 645 SKATGIDKVSGKMLKAAAPAIAQSLSYIFNSSIKTCHFPNDWKIA 689


>SB_27477| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1800

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 20/118 (16%), Positives = 52/118 (44%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
            R+ K +D+     D+++  W  +     ++D  + +     ++ ++H P +++R +    
Sbjct: 1467 RSTKSLDVEKFNEDLSSAPWHVMETFDTMDDKYHYWETLFNTIVEKHMPTKKMRFRKADV 1526

Query: 569  PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
            P++TP+ K  +              TE +  + +  RN+     R A + Y+ +  ++
Sbjct: 1527 PYMTPEWKQAIKMKRKFAKQYAHSKTEENWELKRKWRNKATNCRRKAIKEYWQQKADD 1584


>SB_52393| Best HMM Match : LEA_4 (HMM E-Value=8)
          Length = 203

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 20/118 (16%), Positives = 52/118 (44%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+ K +D+     D+++  W  +     ++D  + +     ++ ++H P +++R +    
Sbjct: 64  RSTKSLDVEKFNEDLSSAPWHVMETFDTMDDKYHYWETLFNTIVEKHMPTKKMRFRKADV 123

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
           P++TP+ K  +              TE +  + +  RN+     R A + Y+ +  ++
Sbjct: 124 PYMTPEWKQAIKMKRKFAKQYAHSKTEENWELKRKWRNKATNCRRKAIKEYWQQKADD 181


>SB_41523| Best HMM Match : bZIP_1 (HMM E-Value=8.8)
          Length = 257

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 20/118 (16%), Positives = 52/118 (44%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+ K +D+     D+++  W  +     ++D  + +     ++ ++H P +++R +    
Sbjct: 100 RSTKSLDVEKFNEDLSSAPWHVMETFDTMDDKYHYWETLFNTIVEKHMPTKKMRFRKADV 159

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
           P++TP+ K  +              TE +  + +  RN+     R A + Y+ +  ++
Sbjct: 160 PYMTPEWKQAIKMKRKFVKQYAHSKTEENWELKRKWRNKATNCRRKAIKEYWQQKADD 217


>SB_25123| Best HMM Match : LEA_4 (HMM E-Value=8)
          Length = 294

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 20/118 (16%), Positives = 52/118 (44%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           R+ K +D+     D+++  W  +     ++D  + +     ++ ++H P +++R +    
Sbjct: 120 RSTKSLDVEKFNEDLSSAPWHVMETFDTMDDKYHYWETLFNTIVEKHMPTKKMRFRKADV 179

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
           P++TP+ K  +              TE +  + +  RN+     R A + Y+ +  ++
Sbjct: 180 PYMTPEWKQAIKMKRKFAKQYAHSKTEENWELKRKWRNKATNCRRKAIKEYWQQKADD 237


>SB_21205| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.75)
          Length = 505

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 63/230 (27%), Positives = 99/230 (43%), Gaps = 30/230 (13%)
 Frame = -3

Query: 611 HAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAI-YKALRNRCNRLCR 435
           H P +++R ++ P PW+   I  L+           + P + SL   +KALR    +  R
Sbjct: 249 HVPSKKLRGRN-PVPWMNGTILDLIKKKETTRRRLKKTPAKASLREKFKALRAEVKQALR 307

Query: 434 DAKRLYFHKSLENRSPAHTWRFL-------KSVGIGK----------------TPV-SSV 327
           +++  +F +SLE     +T RF        KS GI                  TP+ ++ 
Sbjct: 308 ESRENFF-QSLERDYKNNTKRFWSVLKQKSKSRGIPSQVSMATVNPPTGSQDPTPLRTTA 366

Query: 326 KDTDLCA--LNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVS--VADVRNSF 159
            D +  A   NK+F+   V L DS +   L        P +P  ELS +S  + D+ +  
Sbjct: 367 DDPEAIANLFNKYFA--SVFLKDSLQD--LNTDPEHCAPPVP--ELSNISFDINDILSVI 420

Query: 158 FSI-SSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
             + +S A G DN+  +++      +AP L  IFN S     FP  WK A
Sbjct: 421 RGLDASKASGPDNIPVRLLKETAAVIAPSLCQIFNKSIKLGKFPSEWKIA 470


>SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064)
          Length = 756

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 51/244 (20%), Positives = 95/244 (38%), Gaps = 12/244 (4%)
 Frame = -3

Query: 707 VNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXX 528
           +   D S +   H      + F   +    D+  P R VR      PW+   IK  +   
Sbjct: 262 ITTHDCSNLFGAHTCQAKFDVFYNTITDALDRFCPSRVVRSHPSDKPWINNKIKFWIAKR 321

Query: 527 XXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHT---WRFLK-- 363
                            I+K  R R     R  KR ++   +E     +T   WR +K  
Sbjct: 322 QKMLAKFGS-----DFVIFKFWRGRVVSAIRTCKRSFYQSKVEKLKDTNTRRWWREVKNL 376

Query: 362 ---SVGIGKTPVSSVKDTDLCA---LNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIF 201
              S+  G+     + D+ + +   L K  +   V L+   +      +++++VP +P  
Sbjct: 377 TGESMSQGEWYSQLIDDSSIASEDNLCKKINEFFVQLTSDFRPLLPHDVTAIAVPDVPDH 436

Query: 200 ELSPVSVADVRNSFFSI-SSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDS 24
            L  VS  +   S   I ++ A G D + ++++ +    ++PI+ +++N S    +FP  
Sbjct: 437 FL--VSSYEAYKSLRGILTNKAPGPDGIPARILKMFAFGLSPIVAELYNTSLKEGHFPGL 494

Query: 23  WKPA 12
            K A
Sbjct: 495 LKSA 498


>SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14)
          Length = 595

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 47/225 (20%), Positives = 87/225 (38%), Gaps = 12/225 (5%)
 Frame = -3

Query: 644 FNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIK-TLMXXXXXXXXXXXRCPTEHSLAIYK 468
           F+  +   F+++ P+  +       PW+T  IK  +              P  H      
Sbjct: 11  FHSTLTEAFNKYFPINTIHASPSDKPWITHQIKHAISKRQRAFSRGGKGSPAFH------ 64

Query: 467 ALRNRCNRLCRDAKRLYFHKSLENRSPAHT---WRFLKSVGIGKT-------PVSSVKDT 318
             RN+  RL +  KR ++ + +E    ++    W+ +K++  G          +    D 
Sbjct: 65  LWRNKVQRLIKSCKRTFYERKVEALKESNISRWWKEVKALSGGSCRNGKWYDQLLVTSDF 124

Query: 317 D-LCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISST 141
           D L +L    +   V L+      T   ++S  V  +P   L+ +   +   S   I   
Sbjct: 125 DPLESLCNRMNSFFVGLTYDLPPLTTRDVASFQVDEVPARLLATIPEVERALSATKIKK- 183

Query: 140 AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPAAA 6
           A G D + + ++      +AP++ D++N S T   FP   K A A
Sbjct: 184 APGPDGIPNTILKTFSFELAPVICDLYNSSLTDCFFPSPLKSAIA 228


>SB_8907| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 776

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 45/223 (20%), Positives = 88/223 (39%), Gaps = 10/223 (4%)
 Frame = -3

Query: 662 NDMVNSFNYKVISLFDQHAPVRRVRIKHKP-APWLTPDIKTLMXXXXXXXXXXXRCPTEH 486
           N + + ++  +    D+HAPVR   +  +P +PW    ++ L                E 
Sbjct: 103 NVLCDQYSTVLHHFIDKHAPVRTFSVTLRPYSPWYDDSLRLLKRQKRKAERRYVSSRLEI 162

Query: 485 SLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSV-GIGKTPV-SSVKDTDL 312
              +Y+      +     AKR ++   +   +    +R +  +  +   P+  S +    
Sbjct: 163 HRQMYEEKCRAYSTALNVAKRNFYKDQISGSNQTRLFRLIDGLFRVKPVPLLPSYESPQA 222

Query: 311 CALN--KHFSLPPVSLSDSSKTATLLKISSLSVPRIP-----IFELSPVSVADVRNSFFS 153
            A +    F+     L D+ +++ LL +    +P  P       E S VSV+ +R     
Sbjct: 223 LAEDFISFFTTKIQHLKDNLRSSPLLTMEMSVMPAQPQCVASFPEFSAVSVSYIRELLQQ 282

Query: 152 ISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDS 24
               +  +D V + ++   +  +AP +T I N S +S  FP S
Sbjct: 283 SKPKSCILDPVPTSVLKQSIDAIAPAITTIVNASLSSGVFPTS 325


>SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1)
          Length = 291

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = -3

Query: 221 VPRIPIFELSPVSVADVRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFT 45
           +P    FE+  V    V+     + +  A G+D + ++++    P +AP LT I N S  
Sbjct: 20  IPSGTKFEIPKVMQEFVQGYLLQLQTCKATGLDGISARLLRAAAPAIAPSLTKIINQSIK 79

Query: 44  SSNFPDSWKPA 12
           +  FP  WK A
Sbjct: 80  TGRFPTRWKEA 90


>SB_34358| Best HMM Match : DUF1280 (HMM E-Value=7)
          Length = 359

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 4/126 (3%)
 Frame = -3

Query: 707 VNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXX 528
           + +  W  +    +  +    F  K++   D+  P+R VR+     PWLT  IK  +   
Sbjct: 134 ITSYSWDELYNLTSCREKFEWFYRKIMEAIDKFLPMRSVRMHATDKPWLTTAIKIAISKR 193

Query: 527 XXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFH---KSLENRSPAHTWRFLKSV 357
                       E  L  +K+ RN+  RL +  K  +F    KSL++ + A  W+ +K++
Sbjct: 194 QRYLSKYG---KESDL--FKSWRNKVQRLVKQCKGSFFDTKVKSLKDTNTARWWKEVKNL 248

Query: 356 -GIGKT 342
            GI  T
Sbjct: 249 SGISST 254


>SB_43156| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 309

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -3

Query: 188 VSVADVRNSFFSISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           VS  DV      +S   A GID V  KM+    P +A  L  IFN S  + +FP+ WK A
Sbjct: 206 VSDNDVLKPLSGLSKYKATGIDKVSGKMLKAAAPAIAQSLPYIFNSSIKTCHFPNDWKIA 265


>SB_33113| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 185

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -3

Query: 188 VSVADVRNSFFSISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           VS  DV      +S   A GID V  KM+    P +A  L  IFN S  + +FP+ WK A
Sbjct: 82  VSDNDVLKPLSGLSKYKATGIDKVSGKMLKAAAPAIAQSLPYIFNSSIKTCHFPNDWKIA 141


>SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 279

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = -3

Query: 221 VPRIPIFELSPVSVADVRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFT 45
           +P    FE+  V    V+     + +  A G+D + ++++    P +AP LT I N S  
Sbjct: 20  IPSGTKFEIPKVMQEFVQGYLLQLQTCKATGLDGISARLLKAAAPAIAPSLTKIINQSIK 79

Query: 44  SSNFPDSWKPA 12
           +  FP  WK A
Sbjct: 80  TGRFPARWKEA 90


>SB_19845| Best HMM Match : Macscav_rec (HMM E-Value=9.9)
          Length = 146

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -3

Query: 188 VSVADVRNSFFSISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           VS  DV      +S   A GID V  KM+    P +A  L  IFN S  + +FP+ WK A
Sbjct: 43  VSDNDVLKPLSGLSKYKATGIDKVSGKMLKAAAPAIAQSLPYIFNSSIKTCHFPNDWKIA 102


>SB_58486| Best HMM Match : Vicilin_N (HMM E-Value=1.6)
          Length = 424

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -3

Query: 188 VSVADVRNSFFSISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           VS  DV      +S   A GID V  KM+    P +A  L  IFN S  + +FP+ WK A
Sbjct: 206 VSDNDVLKPLSGLSKYKATGIDKVSGKMLKAAAPAIAQSLPYIFNSSIKTCHFPNDWKIA 265


>SB_55395| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -3

Query: 188 VSVADVRNSFFSISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           VS  DV      +S   A GID V  KM+    P +A  L  IFN S  + +FP+ WK A
Sbjct: 43  VSDNDVLKPLSGLSKYKATGIDKVSGKMLKAAAPAIAQSLPYIFNSSIKTCHFPNDWKIA 102


>SB_51811| Best HMM Match : Vicilin_N (HMM E-Value=1.9)
          Length = 406

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -3

Query: 188 VSVADVRNSFFSISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           VS  DV      +S   A GID V  KM+    P +A  L  IFN S  + +FP+ WK A
Sbjct: 189 VSDNDVLKPLSGLSKYKATGIDKVSGKMLKAAAPAIAQSLPYIFNSSIKTCHFPNDWKIA 248


>SB_47673| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1480

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 62/230 (26%), Positives = 99/230 (43%), Gaps = 30/230 (13%)
 Frame = -3

Query: 611  HAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAI-YKALRNRCNRLCR 435
            H P +++R ++ P PW+   I  L+           + P + SL   +KALR    +  R
Sbjct: 1218 HVPSKKLRGRN-PVPWMNGTILDLIKKKETTRRRLKKTPAKASLREKFKALRAEVKQALR 1276

Query: 434  DAKRLYFHKSLENRSPAHTWRFL-------KSVGIGK----------------TPV-SSV 327
            +++  +F +SLE     +T RF        KS G+                  TP+ ++ 
Sbjct: 1277 ESRENFF-QSLERDYKNNTKRFWSVLKQKSKSRGLPSQVSMATVNPPTGSQDPTPLRTTA 1335

Query: 326  KDTDLCA--LNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVS--VADVRNSF 159
             D +  A   NK+F+   V L DS +   L        P +P  ELS +S  + D+ +  
Sbjct: 1336 DDPEAIANLFNKYFA--SVFLKDSLQD--LNTDPEHCAPPVP--ELSNISFDINDILSVI 1389

Query: 158  FSI-SSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
              + +S A G DN+  +++      +AP L  IFN S     FP  WK A
Sbjct: 1390 RGLDASKASGPDNIPVRLLKETAAVIAPSLCQIFNKSIKLGKFPSEWKIA 1439


>SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 1410

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 62/230 (26%), Positives = 99/230 (43%), Gaps = 30/230 (13%)
 Frame = -3

Query: 611 HAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAI-YKALRNRCNRLCR 435
           H P +++R ++ P PW+   I  L+           + P + SL   +KALR    +  R
Sbjct: 256 HVPSKKLRGRN-PVPWMNGTILDLIKKKETTRRRLKKTPAKASLREKFKALRAEVKQALR 314

Query: 434 DAKRLYFHKSLENRSPAHTWRFL-------KSVGIGK----------------TPV-SSV 327
           +++  +F +SLE     +T RF        KS G+                  TP+ ++ 
Sbjct: 315 ESRENFF-QSLERDYKNNTKRFWSVLKQKSKSRGLPSQVSMATVNPPTGSQDPTPLRTTA 373

Query: 326 KDTDLCA--LNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVS--VADVRNSF 159
            D +  A   NK+F+   V L DS +   L        P +P  ELS +S  + D+ +  
Sbjct: 374 DDPEAIANLFNKYFA--SVFLKDSLQD--LNTDPEHCAPPVP--ELSNISFDINDILSVI 427

Query: 158 FSI-SSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
             + +S A G DN+  +++      +AP L  IFN S     FP  WK A
Sbjct: 428 RGLDASKASGPDNIPVRLLKETAAVIAPSLCQIFNKSIKLGKFPSEWKIA 477


>SB_26022| Best HMM Match : DUF1235 (HMM E-Value=4.8)
          Length = 212

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -3

Query: 188 VSVADVRNSFFSISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           VS  DV      +S   A GID V  KM+    P +A  L  IFN S  + +FP+ WK A
Sbjct: 100 VSDNDVLKPLSGLSKYKATGIDKVSGKMLKAAAPAIAQSLPYIFNSSIKTCHFPNDWKIA 159


>SB_12038| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 118

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = -3

Query: 221 VPRIPIFELSPVSVADVRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFT 45
           +P    FE+  V    V+     + +  A G+D + ++++    P +AP LT I N S  
Sbjct: 20  IPSGTKFEIPKVMQEFVQGYLLQLQTCKATGLDGISARLLRAAAPAIAPSLTKIINQSIK 79

Query: 44  SSNFPDSWKPA 12
           +  FP  WK A
Sbjct: 80  TGRFPARWKEA 90


>SB_53870| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 398

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 47/223 (21%), Positives = 87/223 (39%), Gaps = 10/223 (4%)
 Frame = -3

Query: 662 NDMVNSFNYKVISLFDQHAPVRRVRIKHKP-APWLTPDIKTLMXXXXXXXXXXXRCPTEH 486
           N + + ++  +    D+HAPVR   +  +P +PW    ++ L                E 
Sbjct: 103 NVLCDQYSTVLHHFIDKHAPVRTFSVTLRPYSPWYDDSLRLLKRQKRKVERRYVSSRLEI 162

Query: 485 SLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSV-GIGKTPV-SSVKDTDL 312
              +Y       +     AKR +    +   +    +RF+  +  +   PV  S +    
Sbjct: 163 HRQMYVEKCRAYSTALNVAKRNFSKDQISCSNQTQLFRFIDGLFRVKPGPVLPSYESPSA 222

Query: 311 CALN--KHFSLPPVSLSDSSKTATLLKISSLSVPRIP-----IFELSPVSVADVRNSFFS 153
            A +    F+     L D+ +++ LL +    +P  P       E S VSV+ +R     
Sbjct: 223 LAEDFILFFTTKIQHLKDNLRSSPLLTMEMSVMPAQPQCVASFPEFSAVSVSYIRELLHQ 282

Query: 152 ISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDS 24
               +  +D V + ++   +  +AP +T I N S +S  FP S
Sbjct: 283 SKPKSCILDPVPTSILKQSIDAIAPAITSIVNASLSSGVFPTS 325


>SB_45315| Best HMM Match : DUF1235 (HMM E-Value=2.3)
          Length = 269

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -3

Query: 188 VSVADVRNSFFSISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           VS  DV      +S   A GID V  KM+    P +A  L  IFN S  + +FP+ WK A
Sbjct: 100 VSDNDVLKLLSGLSKYKATGIDKVSGKMLKAAAPAIAQSLPYIFNSSIKTCHFPNDWKIA 159


>SB_26857| Best HMM Match : Viral_NABP (HMM E-Value=2.6)
          Length = 526

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 49/264 (18%), Positives = 105/264 (39%), Gaps = 15/264 (5%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP- 573
           R  K +D  A   D+  +   C  ++ N  ++ N +N  +  L  +H P++   I  +P 
Sbjct: 131 RKLKSLDREAFTEDIMVSPLFC-KDYTNTEELSNCYNNVLTKLLHKHVPIKTCTITIRPA 189

Query: 572 APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR 393
           APW   +I+              +   E    +Y       N+L  D++  ++ + ++  
Sbjct: 190 APWYCDNIRKEKAKRRKLKALWRKTRLEVHRQMYTEQCVHVNKLLYDSRMQFYARIIDEN 249

Query: 392 SPAHTWRF-----LKSVGIG-KTPVSSVK----DTDLCALNKHFSLP----PVSLSDSSK 255
           S +    F     L S+    K P  + K    DT +        +     P + +D+++
Sbjct: 250 STSQRTLFSTIQKLLSLNTDKKLPSHTCKRVLADTFIIFFTNKVQVIRKGFPTAETDNNE 309

Query: 254 TATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPI 75
                + +  +     + E  P +V ++ +   ++ S +  +D +   ++      + P+
Sbjct: 310 QILNFEQTQSNYAIPELNEFFPTTVHELSSLVSNMISKSCSLDPLPGSILRDCQGVILPL 369

Query: 74  LTDIFNFSFTSSNFPDSWKPAAAD 3
           +T+I N S + +  P S K A  D
Sbjct: 370 ITNIINLSISEAVVPLSLKEAVLD 393


>SB_24630| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 218

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 24/60 (40%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -3

Query: 188 VSVADVRNSFFSISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           VS  DV      +S   A GID V  KM+    P +A  L  IFN S  + +FP+ WK A
Sbjct: 115 VSDNDVLKLLSGLSKYKATGIDKVSGKMLKAAAPAIAQSLPYIFNSSIKTCHFPNDWKIA 174


>SB_4524| Best HMM Match : Ribosomal_S7e (HMM E-Value=0.59)
          Length = 367

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 50/212 (23%), Positives = 94/212 (44%), Gaps = 17/212 (8%)
 Frame = -3

Query: 596 RVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLY 417
           R  IK    P +T  I T +              +E+ L+ YK  RN+ ++L R +K+ Y
Sbjct: 9   RKEIKSLSKPRITKGIITSIKLKDKFYKKYLVSRSEYYLSKYKCYRNKISQLIRTSKQNY 68

Query: 416 FHK--SLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLP-PVSLSDSSKTAT 246
           +    +  N++  + W  +K + I   P  S + + L   NK    P  ++++ ++  AT
Sbjct: 69  YQNYFATNNKNIKNIWSGIKEL-ITTKPTCSNQPSKLIINNKPVKDPKAIAIAFNNFFAT 127

Query: 245 L-----LKI--------SSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKM 108
           +      KI        S L  P +  F LSPV+  ++ +    ++ S A G  ++   +
Sbjct: 128 IGSQLASKIPHVDRSPESFLGPPLVNSFVLSPVTAFEIEDIISGLNPSKASGPYSIPVCL 187

Query: 107 IALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           +  +   ++  L  + N SF++   PD +K A
Sbjct: 188 LKFLKSYLSVPLEILHNHSFSNGCVPDQFKIA 219


>SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1251

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 45/204 (22%), Positives = 81/204 (39%), Gaps = 15/204 (7%)
 Frame = -3

Query: 578  KPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLE 399
            +  PW+TP++K ++           +   +   A + A R    +    A   Y    L+
Sbjct: 487  RDVPWMTPNVKRMIKRKKRLYNLQRKSGRKDHKANFMAARRAVKKALNTAHNEYVMGLLD 546

Query: 398  -NRSPAHT---------WRFLKSVGIGKTPVSSVKDTDL---CALNKHFSLPPVSLSDSS 258
             N   ++          W+++KS+      ++++KD D     + +K  +       +S 
Sbjct: 547  VNEKESNVERFNTGRKFWKYIKSLRKENVSIATMKDQDSGLEVSSSKEKAEVLSKQFESV 606

Query: 257  KTATLLKISSLSV-PRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTV 84
             T     +  LSV PR P       SV  +      ++ S A G D + S+++      V
Sbjct: 607  FTQENPNLPDLSVLPRWPCMSNLQFSVNGIEKLLSKVNPSKANGPDMIPSRVLQECAHEV 666

Query: 83   APILTDIFNFSFTSSNFPDSWKPA 12
            A  L  IFN+S++    PD W  A
Sbjct: 667  AIYLEIIFNYSYSVQELPDDWLTA 690


>SB_41509| Best HMM Match : Exo_endo_phos (HMM E-Value=4.7e-05)
          Length = 670

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 24/99 (24%), Positives = 43/99 (43%)
 Frame = -3

Query: 752 LRNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP 573
           +RN K  +     RD+    W  I+   + N M + +    +++ D+HAPV+  + K   
Sbjct: 571 IRNMKKFNQELFARDLLAQPWEQIVLCPDANKMWDFWRDLFLNVLDKHAPVQLKKKKTFS 630

Query: 572 APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRN 456
            PW+T +I+ L+                    +YK+ RN
Sbjct: 631 DPWVTKEIRELIIHRDKAKRKAVVSKLSSDWEVYKSFRN 669


>SB_41296| Best HMM Match : RVT_1 (HMM E-Value=2.8e-24)
          Length = 568

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 45/225 (20%), Positives = 89/225 (39%), Gaps = 10/225 (4%)
 Frame = -3

Query: 662 NDMVNSFNYKVISLFDQHAPVRRVRIKHKP-APWLTPDIKTLMXXXXXXXXXXXRCPTEH 486
           N + + ++  +    ++HAPVR   +  +P +PW    ++ L                E 
Sbjct: 103 NVLCDQYSTVLNHFIEKHAPVRTFSVTLRPYSPWYDDSLRLLKRQKRKAERRYVSSRLEI 162

Query: 485 SLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTP--VSSVKDTDL 312
              +Y+      +     AKR ++   +   +    +R    +   K    + S +    
Sbjct: 163 HRQMYEEKCKAYSTALNVAKRNFYKDQISGSNQTQLFRLYDGLFRVKPVRLLPSYESPQA 222

Query: 311 CALN--KHFSLPPVSLSDSSKTATLLKISSLSVPRIP-----IFELSPVSVADVRNSFFS 153
            A +    F+     L D+ +++ LL +    +P  P     I E+S +SV+ +R+    
Sbjct: 223 LAEDFISFFTTKIQHLKDNLRSSPLLTMEMSVMPAQPQCVASIPEISALSVSYIRDLLQQ 282

Query: 152 ISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
               +  +D V +  +   +  +AP +T I N S +S  FP S K
Sbjct: 283 SKPKSCILDPVPTSALKQSIDVIAPAITSIVNASLSSGVFPTSLK 327


>SB_55401| Best HMM Match : Flp_N (HMM E-Value=9.2)
          Length = 203

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/43 (44%), Positives = 24/43 (55%)
 Frame = -3

Query: 140 AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           A GID V  KM+    P +A  L  IFN S  + +FP+ WK A
Sbjct: 117 ATGIDKVSGKMLKAAAPAIAQSLPYIFNSSIKTCHFPNDWKIA 159


>SB_43061| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1396

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/118 (16%), Positives = 51/118 (43%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
            R+ K +D+     D+++  W  +     + D  + +     ++ ++H P +++R +    
Sbjct: 1098 RSTKSLDVEKFNEDLSSAPWHVMETFDTMEDKYHYWETLFNTIVEKHMPTKKMRFRKADV 1157

Query: 569  PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLEN 396
            P++TP+ K  +              TE +  + +  RN+     R A + Y+ +  ++
Sbjct: 1158 PYMTPEWKQAIKMKRKFAKQYAHSKTEENWELKRKWRNKTTNGRRKAIKEYWQQKADD 1215


>SB_16607| Best HMM Match : Flp_N (HMM E-Value=9.2)
          Length = 185

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/43 (44%), Positives = 24/43 (55%)
 Frame = -3

Query: 140 AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           A GID V  KM+    P +A  L  IFN S  + +FP+ WK A
Sbjct: 99  ATGIDKVSGKMLKAAAPAIAQSLPYIFNSSIKTCHFPNDWKIA 141


>SB_4695| Best HMM Match : SAM_1 (HMM E-Value=0.012)
          Length = 1348

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 22/98 (22%), Positives = 43/98 (43%)
 Frame = -3

Query: 707  VNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXX 528
            +    W  + +   + D  ++F+  + +  D + P+R+V+      PW+TP +K+L+   
Sbjct: 944  ITKQSWQAVFDQSLVTDKFDTFSKLLSTAVDVYLPLRKVKCSSSDKPWITPKLKSLIASR 1003

Query: 527  XXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYF 414
                        + S A +K  RN     C  AK+ Y+
Sbjct: 1004 QAALHNSG----KESEA-FKQYRNAVQLECSVAKKSYY 1036


>SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05)
          Length = 1131

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 46/225 (20%), Positives = 88/225 (39%), Gaps = 10/225 (4%)
 Frame = -3

Query: 662  NDMVNSFNYKVISLFDQHAPVRRVRIKHKP-APWLTPDIKTLMXXXXXXXXXXXRCPTEH 486
            N + + +N  +     +HA VR   +  +P +PW    ++ L                E 
Sbjct: 895  NVLCDQYNTVLNHFIGKHALVRTFSVTLRPYSPWYDDSLRLLKRQKRKAERRYVSSRLEI 954

Query: 485  SLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSV-GIGKTPV-SSVKDTDL 312
               +Y+      +     AKR ++   +   +    +R +  +  +   P+  S +    
Sbjct: 955  HRQMYEEKCRAYSIALNVAKRNFYKDQISGSNQTQLFRLIDGLFRVKPVPLLPSYESPQA 1014

Query: 311  CALN--KHFSLPPVSLSDSSKTATLLKISSLSVPRIP-----IFELSPVSVADVRNSFFS 153
             A +    F+     L D+ +++ LL +     P  P       E S VSV+ +R+    
Sbjct: 1015 LAEDFISFFTTKIQHLKDNLRSSPLLTMEMSVTPAQPQCVASFPEFSAVSVSYIRDILQQ 1074

Query: 152  ISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
              S +  +D V + ++   +  +AP +T I N S +S  FP S K
Sbjct: 1075 SKSKSCILDPVPTSVLKQSIDVIAPAITSIVNASLSSGVFPTSLK 1119


>SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1141

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 35/124 (28%), Positives = 61/124 (49%), Gaps = 5/124 (4%)
 Frame = -3

Query: 377 WRFLKSV-GIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVP--RIP 207
           WR LK++  +GK       D ++ +L+ HF        D +KT T    ++LS+P  R  
Sbjct: 198 WRSLKNLFSVGKDKKQQECDLEIESLHSHFM-------DLNKTTT----TNLSIPKCRDQ 246

Query: 206 IFEL-SPVSVADVRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNF 33
              L S + + +V+ +  ++ +  A G DN+ ++++     T+ P LT +FN    S  F
Sbjct: 247 TGPLDSEIRLEEVKLAIENLKNNKAPGHDNILNELLKYGKDTLLPYLTRLFNIILRSGVF 306

Query: 32  PDSW 21
           P  W
Sbjct: 307 PQEW 310


>SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1163

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 49/218 (22%), Positives = 84/218 (38%), Gaps = 1/218 (0%)
 Frame = -3

Query: 668 NINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTE 489
           +++D V  ++     + +  AP+ R++++ K  P++T + K  +           +  T 
Sbjct: 155 DVDDKVYFWSSLFQRITEDSAPMERMKVRDKDVPYMTSEWKQAIRAKRKATSKFLKNKTP 214

Query: 488 HSLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLC 309
            +    +A RN   R  R A +             H WR    +G  K  +SS       
Sbjct: 215 KNWENKRAARNEATRQRRIAIK-------------HYWRKQYGIGGDKAKLSS------- 254

Query: 308 ALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVG 132
                    P    D   T  +L++ S + P     EL PV+   V     S+    A G
Sbjct: 255 ---------PDDFMDHPSTIRILEVCSNTTP---CRELRPVTEGQVLKELHSLKPEKAAG 302

Query: 131 IDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
            D +  K++ +    +A  LT +FN    S  +P SWK
Sbjct: 303 CDAIPPKLLKIGETELAKPLTSLFNSCIKSKVWPGSWK 340


>SB_4381| Best HMM Match : RVT_1 (HMM E-Value=3)
          Length = 471

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 1/71 (1%)
 Frame = -3

Query: 221 VPRIPIFELSPVSVADVRNSFFSI-SSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFT 45
           +P  P F+L  VS  +V      + S T+ G+D +  K + L    ++  +T I N    
Sbjct: 199 LPSRPPFKLRCVSKQEVEQEINKLRSDTSTGVDQIPVKFVKLAKEHISGPITHIINKCIL 258

Query: 44  SSNFPDSWKPA 12
           +SNFP  WK A
Sbjct: 259 TSNFPKLWKIA 269


>SB_13911| Best HMM Match : PAN (HMM E-Value=0.033)
          Length = 534

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 3/85 (3%)
 Frame = -3

Query: 668 NINDMVNSFNYKVISLFDQHAPVRR---VRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRC 498
           ++ND +N     + SL D+HAP+R+    +IK +  PWLT  +   +             
Sbjct: 338 DVNDSINKVISALQSLTDKHAPLRKRTNKQIKQQAKPWLTKAVLNSIKQRQKLFITHFLS 397

Query: 497 PTEHSLAIYKALRNRCNRLCRDAKR 423
                +  YK   N+ NR+   AK+
Sbjct: 398 NDSSKVRFYKIYNNKLNRVKEAAKK 422


>SB_6009| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 895

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 4/107 (3%)
 Frame = -3

Query: 626 SLFDQHAPVRRVRIKHKPA--PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNR 453
           ++++   P+++V+ K      PWLT  +   +             PT      YK  RN+
Sbjct: 534 TIYNNCFPLKKVKTKKSITRKPWLTKGLLRSIKKKNNLYRQFLCSPTLRHEHQYKKFRNK 593

Query: 452 CNRLCRDAKRLYFHKSL-ENRSPA-HTWRFLKSVGIGKTPVSSVKDT 318
            N + + AKR Y+ K L E +S    TWR L  V   +   SS+  T
Sbjct: 594 LNHILKIAKRDYYDKKLSEYKSDVKKTWRILNEVINRRQSNSSLPST 640


>SB_20278| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 334

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 1/64 (1%)
 Frame = -3

Query: 200 ELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDS 24
           + + VS  DV      +S S A GID V  KM+    P +A  L+ IFN S  + +FP+ 
Sbjct: 108 KFTTVSDNDVLKLLSGLSKSKATGID-VSGKMLKAAAPAIAQSLSYIFNSSIKTCHFPND 166

Query: 23  WKPA 12
           WK A
Sbjct: 167 WKIA 170



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = -3

Query: 110 MIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           M+    P +A  L+ IFN S  + +FP+ WK A
Sbjct: 1   MLKAAAPAIAQSLSYIFNSSIKTCHFPNDWKIA 33


>SB_5816| Best HMM Match : RVT_1 (HMM E-Value=3e-16)
          Length = 904

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 30/139 (21%), Positives = 61/139 (43%), Gaps = 4/139 (2%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHK-P 573
           R+ K +D+    + +    W  +    +I+D+V+++     ++ + H P R  R+K +  
Sbjct: 205 RDVKRLDIEKFNQSIQEAPWDAVFVFEDIDDVVHAWEQTFNTVLESHCPWREKRVKRETQ 264

Query: 572 APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLE-- 399
            PW++                  R  +    A Y+  RN+     R AKR ++ KS E  
Sbjct: 265 PPWIS----------------KWRTDSPDDWAKYRIARNKAVCTLRGAKREFYSKSFEEN 308

Query: 398 NRSPAHTWRFLKSV-GIGK 345
             + +  W+ +K++ G+ K
Sbjct: 309 KNNTSAIWKCIKTLSGVTK 327


>SB_58227| Best HMM Match : HSBP1 (HMM E-Value=0.28)
          Length = 565

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 27/94 (28%), Positives = 42/94 (44%), Gaps = 4/94 (4%)
 Frame = -3

Query: 626 SLFDQHAPVRRVRIKHKPA--PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNR 453
           ++++   P+++V+ K      PWLT  +   +             PT      YK  RN+
Sbjct: 309 TIYNNCFPLKKVKTKKSITRKPWLTKGLLRSIKKKNNLYRQFLCSPTLRHEHQYKKFRNK 368

Query: 452 CNRLCRDAKRLYFHKSL-ENRSPA-HTWRFLKSV 357
            N + + AKR Y+ K L E +S    TWR L  V
Sbjct: 369 LNHILKIAKRDYYDKKLSEYKSDVKKTWRILNEV 402


>SB_17276| Best HMM Match : E-MAP-115 (HMM E-Value=0.57)
          Length = 618

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -3

Query: 188 VSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           VS  DV      +S S A GID V  KM+    P +   L+ IFN S  + + P+ WK A
Sbjct: 187 VSDNDVLKLLSGLSKSKATGIDKVSGKMLKAAAPAIVQSLSYIFNSSIKTCHIPNDWKIA 246


>SB_52970| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 203

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -3

Query: 188 VSVADVRNSFFSISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           VS  DV      +S   A GID V  KM+    P +A  L  IF+ S  + +FP+ WK A
Sbjct: 100 VSDNDVLKLLSGLSKYKATGIDKVSGKMLKAAAPAIAQSLPYIFSSSIKTCHFPNDWKIA 159


>SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 591

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 56/254 (22%), Positives = 105/254 (41%), Gaps = 10/254 (3%)
 Frame = -3

Query: 743 YKGIDLGALRRDVNN--TDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           Y  +D+  L RD     +++    E  ++    + F   ++S  ++H P +  + K    
Sbjct: 157 YDKMDVEGLHRDAMTLASEFFSSCESRSVESNWSHFKNGLLSAVEKHVPSKLTKSKLS-L 215

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLA--IYKALRNRCNRLCRDAKRLYFH----K 408
           PW++P IK LM           R   + S     Y+  RN+  +  + A   Y +    +
Sbjct: 216 PWMSPTIKRLMRKRDSLLLRAKRSNNKSSEVWRAYRQQRNKVVKALKVAHNNYLNDVIGE 275

Query: 407 SLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISS 228
           SL++  P   WR++K                  + +++  +P +    +S    L  +S+
Sbjct: 276 SLQS-DPKKFWRYVKR-----------------SRSENVGIPTLQRF-TSDNGQLPDLST 316

Query: 227 LSVPRIP-IFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIFNF 54
            S P I  I    P     +R    S++ S +VG D +  +++  +   ++ +LT IF  
Sbjct: 317 SSYPTIKDIIFTEP----GIRKQLESLNPSKSVGPDGLSPRILRDLSSEISNVLTFIFQQ 372

Query: 53  SFTSSNFPDSWKPA 12
           SF S   P+ W  A
Sbjct: 373 SFDSGILPEDWLKA 386


>SB_11573| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 405

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 19/63 (30%), Positives = 33/63 (52%)
 Frame = -3

Query: 728 LGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDI 549
           L   RR  N  DWS      N+ + V   N  + S+F++  P+ RV++  +  P+++P +
Sbjct: 113 LSKARRKTNVFDWSPTNNLANLEESVELLNASLWSMFNECFPLIRVKVSSRDPPYMSPLV 172

Query: 548 KTL 540
           K L
Sbjct: 173 KHL 175


>SB_3992| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 354

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 46/175 (26%), Positives = 72/175 (41%), Gaps = 17/175 (9%)
 Frame = -3

Query: 491 EHSLAIYKALRNRCNRLCRDAKRLYFHK---SLENRSPAHTWRFLKSVGIGKTPVSSVKD 321
           +  +  YK   N  + L   +K+ YFH    S +N   A TW+ +  +   KT   S   
Sbjct: 11  QEKVIAYKQYSNTLSHLLNKSKKEYFHSQFISCKNNLKA-TWKLIGKLIQRKTKGQSAPS 69

Query: 320 ------------TDLC-ALNKHFSLPPVSLSDSSKT-ATLLKISSLSVPRIPIFELSPVS 183
                       +D+   LNK F+    +L+   K   ++   S +       F +SPVS
Sbjct: 70  RITSGNRSFTNPSDIADQLNKFFTNVGTNLASQIKDDKSISPTSYIKQSTTSSFVMSPVS 129

Query: 182 VADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
            A V + F S++     I  + +K I L    +A   T I+N S  S   PD +K
Sbjct: 130 EAQVFSLFASLNENKSYI-TIPNKFIKLSASILASPFTAIYNESIASGEVPDIFK 183


>SB_32313| Best HMM Match : RnaseH (HMM E-Value=2.5)
          Length = 721

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 29/128 (22%), Positives = 52/128 (40%), Gaps = 1/128 (0%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           RN +  +L A  R +    W+ IL      +    F   +    + + P++RV++     
Sbjct: 364 RNLRCSNLDAFGRWITQFCWNAILSLQTAREKFERFYTVITDAVNTYLPLQRVQVCATNK 423

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDA-KRLYFHKSLENR 393
           PW+   + +L+           +        +YK LRN+  R C+   KR Y +K    +
Sbjct: 424 PWIGTSLCSLIARRQKALTTLGK-----DSRLYKELRNQVQRECKVCRKRYYSNKVAALK 478

Query: 392 SPAHTWRF 369
             A TW +
Sbjct: 479 RLASTWPY 486


>SB_28679| Best HMM Match : RVT_1 (HMM E-Value=9.3e-08)
          Length = 948

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 48/205 (23%), Positives = 77/205 (37%), Gaps = 3/205 (1%)
 Frame = -3

Query: 617 DQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLC 438
           D   P +   I+    PW+   +K L+               E +   Y+ LRNR NR  
Sbjct: 258 DTLVPQKTKTIQSNEPPWMNCKLKKLIRTRQKAL-------AEGNQDQYRKLRNRVNRER 310

Query: 437 RDAKRLYFHKSLEN---RSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLS 267
           +  +  Y+   +E+     P+  WR   + G     + ++ DT    +N  F  P     
Sbjct: 311 KSCRSKYYDAKVEHLKESKPSTWWREHIASGQEAGCLKNIADT----INTAFLSPMNVFE 366

Query: 266 DSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPT 87
             S+   L   S      + + +LS +      N      S A G D +   ++      
Sbjct: 367 PLSEKCHLTPESEGHAYTLQVSQLSVLKKLAELNP-----SKACGPDGMPGWILKENADF 421

Query: 86  VAPILTDIFNFSFTSSNFPDSWKPA 12
           +A  +TDI N SF  +  P SWK A
Sbjct: 422 LAEPVTDILNCSFKEARLPQSWKDA 446


>SB_18340| Best HMM Match : Vicilin_N (HMM E-Value=1.5)
          Length = 406

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -3

Query: 188 VSVADVRNSFFSISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           VS  DV      +S   A GID V  KM+    P +A  L  IF+ S  + +FP+ WK A
Sbjct: 189 VSDNDVLKLLSGLSKYKATGIDKVSGKMLKAAAPAIAQSLPYIFSSSIKTCHFPNDWKIA 248


>SB_14635| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 179

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = -3

Query: 188 VSVADVRNSFFSISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           VS  DV      +S   A GID V  KM+    P +A  L  IF+ S  + +FP+ WK A
Sbjct: 100 VSDNDVLKLLSGLSKYKATGIDKVSGKMLKAAAPAIAQSLPYIFSSSIKTCHFPNDWKIA 159


>SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 430

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 14/41 (34%), Positives = 25/41 (60%)
 Frame = -3

Query: 140 AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
           A+G+D + ++++     T+AP +T++ N S  S  FP  WK
Sbjct: 55  AIGLDKISARLLKNSARTIAPSITNMLNLSIRSGKFPKLWK 95


>SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33)
          Length = 365

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 14/41 (34%), Positives = 25/41 (60%)
 Frame = -3

Query: 140 AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
           A+G+D + ++++     T+AP +T++ N S  S  FP  WK
Sbjct: 103 AIGLDKISARLLKNSARTIAPSITNMLNLSIRSGKFPKLWK 143


>SB_45447| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1200

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 33/166 (19%), Positives = 76/166 (45%), Gaps = 7/166 (4%)
 Frame = -3

Query: 497  PTEHSL-AIYKALRNRCNRLCRDAKRLYFHK---SLENRSPAHTWRFLKSVGIGKTPVSS 330
            P +  L A+ K  +    +LCR  K  +++    S++ R+  +TW+ +  +    T   S
Sbjct: 728  PDQRELGAVLKEKKKSFKKLCRRKKYTHYNNIVNSIDFRNSKNTWKQINRIFNSNTHKQS 787

Query: 329  --VKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFF 156
              ++  +    ++HF     ++ +S  T   ++ + ++  + P+      +  ++ N+  
Sbjct: 788  HQIRPEEAAVFHQHFEQLNATI-ESQNTMEEVEKTRINNRQGPLDH--EFTELEITNAIK 844

Query: 155  SISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSW 21
            S+ +  A G DN+ ++++     T+   L  +FN    S  +P SW
Sbjct: 845  SLKTGKAPGADNILNEVLKCGEETLKKPLQILFNKILNSGEYPSSW 890


>SB_31815| Best HMM Match : Lipase_GDSL (HMM E-Value=0.0024)
          Length = 1163

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 33/166 (19%), Positives = 76/166 (45%), Gaps = 7/166 (4%)
 Frame = -3

Query: 497  PTEHSL-AIYKALRNRCNRLCRDAKRLYFHK---SLENRSPAHTWRFLKSVGIGKTPVSS 330
            P +  L A+ K  +    +LCR  K  +++    S++ R+  +TW+ +  +    T   S
Sbjct: 973  PDQRELGAVLKEKKKSFKKLCRRKKYTHYNNIVNSIDFRNSKNTWKQINRIFNSNTHKQS 1032

Query: 329  --VKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFF 156
              ++  +    ++HF     ++ +S  T   ++ + ++  + P+      +  ++ N+  
Sbjct: 1033 HQIRPEEAAVFHQHFEQLNATI-ESQNTMEEVEKTRINNRQGPLDH--EFTELEITNAIK 1089

Query: 155  SISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSW 21
            S+ +  A G DN+ ++++     T+   L  +FN    S  +P SW
Sbjct: 1090 SLKTGKAPGADNILNEVLKCGEETLKKPLQILFNKILNSGEYPSSW 1135


>SB_18991| Best HMM Match : RVT_1 (HMM E-Value=2.8e-34)
          Length = 899

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 55/267 (20%), Positives = 102/267 (38%), Gaps = 20/267 (7%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDM---VNSFNYKVISLFDQHAPVR-RVRIK 582
           R  K IDL  L+ ++  +           N++   V  +N  +  L ++HAP + R R+ 
Sbjct: 13  RRLKSIDLEQLKAEMLRSPLCTKDSPSTANELDIYVKEYNNTLAKLLNRHAPNKTRTRVT 72

Query: 581 HKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSL 402
               PW   +I               +      LA +K  RN        A+  Y+ + +
Sbjct: 73  RPVVPWYNDEIDQAKRARRKAERKWRKSKLPSDLADFKKKRNHVTNAMNKARDEYYTQFV 132

Query: 401 -ENRSPAHTWRFLKSVGIG-----KTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLL 240
            EN S         S  +G     + P  + K      + ++F +  ++   +   AT L
Sbjct: 133 AENSSDQRKLFDAASKLLGGNTRLRFPEHANKTVLANDIGRYF-VRKINTIRADIDATSL 191

Query: 239 KISSLS-VP---------RIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILP 90
               +  VP         R      + +S +DV N     +     +D + + ++   L 
Sbjct: 192 SSQDVELVPPDRPWSSKNRTLDTHFNTLSESDVNNLMSGSAKKTCILDPLPTCLVYDSLE 251

Query: 89  TVAPILTDIFNFSFTSSNFPDSWKPAA 9
            + P++T++ N S ++ +FP  WK AA
Sbjct: 252 VLLPVITNMVNSSLSTGHFPADWKEAA 278


>SB_2424| Best HMM Match : RVT_1 (HMM E-Value=6.2e-18)
          Length = 657

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 21/70 (30%), Positives = 36/70 (51%)
 Frame = -3

Query: 221 VPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTS 42
           VPR+  F+L  ++  DVR    +   T+  +D + + ++      + P++T + N S  S
Sbjct: 152 VPRMEAFKL--LTEEDVRMLIKNSKCTSCCLDPIPTHLLKSCSEPLVPVITKLINNSLES 209

Query: 41  SNFPDSWKPA 12
             FPD WK A
Sbjct: 210 GIFPDCWKEA 219


>SB_58397| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 281

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 49/177 (27%), Positives = 73/177 (41%), Gaps = 17/177 (9%)
 Frame = -3

Query: 497 PTEHSLAIYKALRNRCNRLCRDAKRLYFHK---SLENRSPAHTWRFLKSVGIGKTPVSSV 327
           P E  +A YK   N  + L   +K+ YFH    S +N   A TW+ +  +   KT   S 
Sbjct: 28  PLEKVIA-YKQYSNTLSHLLNKSKKEYFHSQFISCKNNLKA-TWKLIGKLIQRKTKGQSA 85

Query: 326 KD------------TDLC-ALNKHFSLPPVSLSDSSKT-ATLLKISSLSVPRIPIFELSP 189
                         +D+   LNK F+    +L+   K   ++   S +       F +SP
Sbjct: 86  PSRITSGNRSFTNPSDIADQLNKFFTNVGTNLASQIKDDKSISPTSYIKQSTTSSFVMSP 145

Query: 188 VSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
           VS A V   F S++     I  + +K I L    +A   T I+N S  S   PD +K
Sbjct: 146 VSEAQVFLLFASLNENKSYI-TIPNKFIKLSASILASPFTAIYNESIASGEVPDIFK 201


>SB_53690| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 196

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 20/68 (29%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP- 573
           R  + +D+  L  D+ N++     +  NIN++V  ++  + +L D+HAP++   +  +P 
Sbjct: 27  RKLRSVDIDQLSEDLLNSELFQN-QQVNINNLVIKYDNTLKALLDKHAPLKAKLVTIRPK 85

Query: 572 APWLTPDI 549
           A W TP+I
Sbjct: 86  AAWYTPEI 93


>SB_32319| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 551

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 33/166 (19%), Positives = 76/166 (45%), Gaps = 7/166 (4%)
 Frame = -3

Query: 497 PTEHSL-AIYKALRNRCNRLCRDAKRLYFHK---SLENRSPAHTWRFLKSVGIGKTPVSS 330
           P +  L A+ K  +    +LCR  K  +++    S++ R+  +TW+ +  +    T   S
Sbjct: 25  PDQRELGAVLKEKKKSFKKLCRRKKYTHYNNIVNSIDFRNSKNTWKQINRIFNSNTHKQS 84

Query: 329 --VKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFF 156
             ++  +    ++HF     ++ +S  T   ++ + ++  + P+      +  ++ N+  
Sbjct: 85  HQIRPEEAAVFHQHFEQLNATI-ESQNTMEEVEKTRINNRQGPLDH--EFTELEITNAIK 141

Query: 155 SISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSW 21
           S+ +  A G DN+ ++++     T+   L  +FN    S  +P SW
Sbjct: 142 SLKTGKAPGADNILNEVLKCGEETLKKPLQILFNKILNSGEYPSSW 187


>SB_22944| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2468

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 47/230 (20%), Positives = 88/230 (38%), Gaps = 11/230 (4%)
 Frame = -3

Query: 668  NINDMVNSFNYKVISLFDQHAPVRRVRIKHKP-APWLTPDIKTLMXXXXXXXXXXXRCPT 492
            NIN++V  ++  + +L D+HAP++   +  +P A W TP++                   
Sbjct: 2032 NINNLVIKYDNTLKALLDKHAPLKAKLVTIRPKAAWYTPEVSEEKRKRRRLERKWVSTGL 2091

Query: 491  EHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRF------LKSVGIGKTPVSS 330
                A Y       N L    K  Y+   ++  S      F       +   +   PV+S
Sbjct: 2092 STDRANYAYQCGVVNNLIDSLKTSYYTSIIQEHSLDQKVHFKTINKLFEKKSVQYYPVAS 2151

Query: 329  VKDTDLCALNKHFS--LPPVSLSDSSKTATLLKISSL--SVPRIPIFELSPVSVADVRNS 162
              +    +    F+  +  + L D  +  T++  +        + + E   +S  DV+  
Sbjct: 2152 SSEVLANSFADFFNEKISKIHL-DLMEQQTMVGPNPYCDHTCTVEMSEFDVISEDDVKIL 2210

Query: 161  FFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
                 S +  +D + + ++     T+ PI+T I N S +S   PD  K A
Sbjct: 2211 AHKPISKSCNLDPLPASLLKECFSTLLPIITRIVNASLSSGVMPDPMKVA 2260


>SB_10854| Best HMM Match : Hormone_4 (HMM E-Value=8.4)
          Length = 217

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 3/69 (4%)
 Frame = -3

Query: 209 PIFELSPVS--VADVRNSFFSI-SSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSS 39
           P+ ELS +S  V D+ +    + +S A G DN+  +++      +AP L  IFN S    
Sbjct: 56  PVPELSNISFDVNDILSVIRGLDASKASGPDNIPVRLLKETAAVIAPSLCQIFNKSIKLG 115

Query: 38  NFPDSWKPA 12
            FP  WK A
Sbjct: 116 KFPSEWKIA 124


>SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 4865

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 25/112 (22%), Positives = 47/112 (41%), Gaps = 1/112 (0%)
 Frame = -3

Query: 749  RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP- 573
            R  K ID  A   D++ ++  C         +V+ +N  +  L D+HAP++   +  +P 
Sbjct: 4626 RKVKAIDTTAFMSDLSASEL-CQDPPSETVQLVDCYNKTLAGLLDRHAPLKTKTVTVRPQ 4684

Query: 572  APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLY 417
             PW + +I+                 +   LA +K  +N    L ++AK  +
Sbjct: 4685 VPWYSEEIREAKRVRRRAERKWRTTRSADDLASFKRHKNHVTYLLKEAKSAF 4736


>SB_42535| Best HMM Match : Bac_transf (HMM E-Value=2.7)
          Length = 245

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP- 573
           R  + +D+  L  D+ N++     +  NIN++V  ++  + +L D+HAP++   +  +P 
Sbjct: 83  RKLRSVDIDQLSEDLLNSELFQN-QQVNINNLVIKYDNTLKALLDKHAPLKAKLVTIRPK 141

Query: 572 APWLTPDI 549
           A W TP++
Sbjct: 142 AAWYTPEV 149


>SB_27190| Best HMM Match : PAN (HMM E-Value=0.13)
          Length = 709

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP- 573
           R  + +D+  L  D+ N++     +  NIN++V  ++  + +L D+HAP++   +  +P 
Sbjct: 298 RKLRSVDIDQLSEDLLNSELFQN-QQVNINNLVIKYDNTLKALLDKHAPLKAKLVTIRPK 356

Query: 572 APWLTPDI 549
           A W TP++
Sbjct: 357 AAWYTPEV 364


>SB_18097| Best HMM Match : NadA (HMM E-Value=2.2)
          Length = 272

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 48/169 (28%), Positives = 78/169 (46%), Gaps = 15/169 (8%)
 Frame = -3

Query: 473 YKALRNRCNRLCRDAKRLYFH----KSLENRSPAHTWRFLK-----SVGIG---KTPVSS 330
           Y+  RN+  +  + A   Y +    +SL++  P   WR++K     +VGI    K  +  
Sbjct: 33  YRQQRNKVVKALKVAHNNYLNDVIRESLQS-DPKKFWRYVKRSRSENVGIPTLRKDNMLF 91

Query: 329 VKDTDLC-ALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIP-IFELSPVSVADVRNSFF 156
           + D D   ALN HF    V  SD+ +   L  +S+ S P I  I    P     +R    
Sbjct: 92  ISDADKAEALNHHFQ--SVFTSDNGQ---LPDLSTSSYPTIKDIIFTEP----GIRKQLE 142

Query: 155 SIS-STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           S++ S +VG D +  +++  +   ++ +LT IF  SF S   P+ W  A
Sbjct: 143 SLNPSKSVGPDGLSPRILRDLSSEISNVLTFIFQQSFDSGILPEDWLKA 191


>SB_1967| Best HMM Match : ubiquitin (HMM E-Value=4.7e-12)
          Length = 348

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP- 573
           R  + +D+G L  D+ N++     +  NIN++V  ++  + +L D+ AP++   +  +P 
Sbjct: 280 RKLRSVDIGQLSEDLLNSELFQN-QQVNINNLVIKYDNTLKALLDKQAPLKAKLVTIRPK 338

Query: 572 APWLTPDI 549
           A W TP++
Sbjct: 339 AAWYTPEV 346


>SB_13896| Best HMM Match : bZIP_1 (HMM E-Value=3.6)
          Length = 314

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 39/155 (25%), Positives = 61/155 (39%), Gaps = 3/155 (1%)
 Frame = -3

Query: 473 YKALRNRCNRLCRDAKRLYFHKSLEN---RSPAHTWRFLKSVGIGKTPVSSVKDTDLCAL 303
           Y+ LRNR NR  +  +  Y+   +E+     P   WR   +       + ++ DT    +
Sbjct: 24  YRKLRNRVNRERKSCRSKYYDAKVEHLKESKPPTWWREHIASDQEAGCLKNIADT----I 79

Query: 302 NKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDN 123
           N  F  P       S+   L   S      + +F+LS +      N      S A G D 
Sbjct: 80  NTAFLSPMNVFEPLSEKCHLTPESEGHAYTLQVFQLSVLKKLAELNP-----SKACGPDG 134

Query: 122 VCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
           +   ++      +A  +TDI N SF  +  P SWK
Sbjct: 135 MPGWILKENADLLAEPVTDILNCSFKEARLPQSWK 169


>SB_7667| Best HMM Match : DUF827 (HMM E-Value=0.33)
          Length = 806

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP- 573
           R  + +D+  L  D+ N++     +  NIN++V  ++  + +L D+HAP++   +  +P 
Sbjct: 222 RKLRSVDIDQLSEDLLNSELFQN-QQVNINNLVIKYDNTLKALLDKHAPLKAQIVTIRPK 280

Query: 572 APWLTPDI 549
           A W TP++
Sbjct: 281 AAWYTPEV 288


>SB_6740| Best HMM Match : RVT_1 (HMM E-Value=4.5e-22)
          Length = 884

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 1/89 (1%)
 Frame = -3

Query: 281 PVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMI 105
           P    D   T  +L++ S + P     EL PV+   V     S+    A G D +  K++
Sbjct: 115 PDDFMDHPSTIRILEVCSNTTP---CRELRPVTEGQVLKELHSLKPEKAAGCDAIPPKLL 171

Query: 104 ALILPTVAPILTDIFNFSFTSSNFPDSWK 18
            +    +A  LT +FN    S  +P SWK
Sbjct: 172 KIGETELAKPLTSLFNSCIKSKVWPGSWK 200


>SB_33535| Best HMM Match : RVT_1 (HMM E-Value=1.4013e-45)
          Length = 469

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 33/166 (19%), Positives = 75/166 (45%), Gaps = 7/166 (4%)
 Frame = -3

Query: 497 PTEHSL-AIYKALRNRCNRLCRDAKRLYFHK---SLENRSPAHTWRFLKSVGIGKTPVSS 330
           P +  L A+ K  +    +LCR  K  +++    S++ R+  +TW+ +  +    T   S
Sbjct: 25  PDQRELGAVLKEKKKSFKKLCRRKKYTHYNNIVNSIDFRNSKNTWKQINRIFNSNTHKQS 84

Query: 329 --VKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFF 156
             ++  +    ++HF     ++ +S  T    + + ++  + P+      +  ++ N+  
Sbjct: 85  HQIRPEEAAVFHQHFEQLNATI-ESQNTMEEAEKTRINNRQGPLDH--GFTELEITNAIK 141

Query: 155 SISS-TAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSW 21
           S+ +  A G DN+ ++++     T+   L  +FN    S  +P SW
Sbjct: 142 SLKTGKAPGADNILNEVLKCGEETLKKPLQILFNKILNSGEYPSSW 187


>SB_31961| Best HMM Match : EGF (HMM E-Value=0)
          Length = 2813

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
 Frame = -3

Query: 203  FELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPD 27
            F +  ++   V      I+ + A GID + ++++ +  P +AP +  + N S +S  FP 
Sbjct: 2038 FSVPAITSTQVARIIMKINPNKASGIDKISARLLRI--PAIAPSIAKLINLSLSSGTFPK 2095

Query: 26   SWKPA 12
             WK A
Sbjct: 2096 RWKLA 2100


>SB_8909| Best HMM Match : LRR_2 (HMM E-Value=0.34)
          Length = 568

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 51/235 (21%), Positives = 91/235 (38%), Gaps = 12/235 (5%)
 Frame = -3

Query: 680 LEHHNINDMVNSFNYKVISLFDQHAPVRR--VRIKHKPAPWLTPDIKTLMXXXXXXXXXX 507
           + + NIN++V  ++  + +L D+HAP++   V I+ K A W TP++              
Sbjct: 167 MSYVNINNLVIKYDNTLKALLDKHAPLKAKLVTIRTK-AAWYTPEVSEEKRKRRRLERKW 225

Query: 506 XRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRF------LKSVGIGK 345
                    A Y       N L    K  Y+   ++  S      F      L+   +  
Sbjct: 226 VSTGLSTDRANYAYQCGVVNNLIDSLKTSYYTSIIQEHSLDQKVLFKTINKLLEKKSVQY 285

Query: 344 TPVSSVKDTDLCALNKHFS--LPPVSLSDSSKTATLLKISSL--SVPRIPIFELSPVSVA 177
            PVSS  +         F+  +  + L D  +  T++  +        + + E   +S  
Sbjct: 286 YPVSSSSEVLANNFADFFNEKISKIHL-DLMEQQTMVGPNPYCDHTCTVEMSEFDVISED 344

Query: 176 DVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           DV+       S +  +D + + ++     T+ PI+T I N S +S   PD  K A
Sbjct: 345 DVKILAHKPISKSCNLDPLPASLLKGCFSTLLPIITRILNASLSSGVMPDPMKVA 399


>SB_53096| Best HMM Match : PHD (HMM E-Value=0.001)
          Length = 623

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 49/236 (20%), Positives = 88/236 (37%), Gaps = 15/236 (6%)
 Frame = -3

Query: 674  HHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCP 495
            H  IN+  + F   +  +  +H P + +  +    PW+T  IK L+            C 
Sbjct: 309  HKLINENYDFFKTTITEIMKKHIPQKNISGRWN-LPWITSSIKRLIRKKQRLYNHAKHCN 367

Query: 494  TEHSLAIYKALRNRCNRLCRDAKRLYFHKSLE----NRSPAHT-----WRFLKSVGIGKT 342
               +   +K LR    +    A   Y  + L     + +  HT     W ++KS      
Sbjct: 368  NHAAWKKFKDLRKLVKKNLAKAHSEYVSQLLTVPEGSETANHTITKRFWTYIKSKKTHDV 427

Query: 341  PVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRI-----PIFELSPVSVA 177
             V+ ++D D   L    SL       S   +     ++ S+P +     P    + +S+ 
Sbjct: 428  GVAPLRD-DKGELVSD-SLGKARALSSQFQSVFTHENNSSIPTLGPSPYPTIPSTLISID 485

Query: 176  DVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
             V     +++   A G D +  K++      +AP LT +F  S  +   P+ W  A
Sbjct: 486  GVIKLLQNVNPKKANGPDLIPCKILQEAAHEIAPALTFLFTQSLETGTLPNDWLSA 541


>SB_52564| Best HMM Match : Exo_endo_phos (HMM E-Value=3.2e-09)
          Length = 748

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 59/260 (22%), Positives = 104/260 (40%), Gaps = 16/260 (6%)
 Frame = -3

Query: 743  YKGIDLGALRRDVNN--TDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
            Y   D+ AL+  + +   D++      ++ +  N+ +  +    ++  P +  + K +  
Sbjct: 361  YHKADMAALKEHIASFHRDYAASHMERSVEENWNAISTCISDAMERFIPSKTSKTK-RHL 419

Query: 569  PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK-----S 405
            PW+   IK LM           R   E     YK LRN  +   +++   Y  +      
Sbjct: 420  PWIGAPIKKLMRKRDRAFKKSKRTGKEKDHVNYKRLRNIVSNSIKESHNNYVSEIMKGID 479

Query: 404  LENRSPA-----HTWRFLKSVGIGKTPVSSVK-DTDLCALNKHFSLPPVSLSDSSKTAT- 246
            LE+  P        W +LK +      + ++  +  +CA +K  +    +  DS  T   
Sbjct: 480  LESDEPRPNGVKRAWSYLKLLRSESLGIPTLFWEGRVCANDKCKAEALRAQYDSVFTQED 539

Query: 245  LLKISSLSV-PRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPIL 72
             L + +L   P   I ++S  SV  VR    +I    A G D V ++++      +APIL
Sbjct: 540  NLNVPTLGASPHQDIKDIS-FSVNGVRVQLDNIRVDKACGPDAVPARVLKEAATELAPIL 598

Query: 71   TDIFNFSFTSSNFPDSWKPA 12
            T +F  S      P  WK A
Sbjct: 599  TLLFEQSMKDGVLPTVWKDA 618


>SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1332

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 18/68 (26%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP- 573
           +  + +D+  L  D+ N++     +  NIN++V  ++  + +L D+HAP++   +  +P 
Sbjct: 417 KKLRSVDIDQLSEDLLNSE-HFQNQQVNINNLVIKYDNTLKALLDKHAPLKAKLVTIRPK 475

Query: 572 APWLTPDI 549
           A W TP++
Sbjct: 476 AAWYTPEV 483


>SB_15517| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05)
          Length = 799

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%)
 Frame = -3

Query: 194 SPVSVADVRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
           S ++ ++VR +  SI+   A G DN+  + +  +   ++P LT IFN   + S +P  WK
Sbjct: 736 SEITNSEVREALESINPLKATGYDNIPPRFLKPVANEISPSLTRIFNRVISDSVWPSDWK 795


>SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 1009

 Score = 37.1 bits (82), Expect = 0.015
 Identities = 59/260 (22%), Positives = 104/260 (40%), Gaps = 16/260 (6%)
 Frame = -3

Query: 743  YKGIDLGALRRDVNN--TDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
            Y   D+ AL+  + +   D++      ++ +  N+ +  +    ++  P +  + K +  
Sbjct: 331  YHKADMAALKEHIASFHRDYAASHMERSVEENWNAISTCISDTMERFIPSKTSKTK-RHL 389

Query: 569  PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK-----S 405
            PW+   IK LM           R   E     YK LRN  +   +++   Y  +      
Sbjct: 390  PWIGAPIKKLMRKRDRAFKKSKRTGKEKDHVNYKRLRNIVSNSIKESHNNYVSEIMKGID 449

Query: 404  LENRSPA-----HTWRFLKSVGIGKTPVSSVK-DTDLCALNKHFSLPPVSLSDSSKTAT- 246
            LE+  P        W +LK +      + ++  +  +CA +K  +    +  DS  T   
Sbjct: 450  LESDEPRPNGVKRAWSYLKLLRSESLGIPTLFWEGRVCANDKCKAEALRAQYDSVFTQED 509

Query: 245  LLKISSLSV-PRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMIALILPTVAPIL 72
             L + +L   P   I ++S  SV  VR    +I    A G D V ++++      +APIL
Sbjct: 510  NLNVPTLGASPHQDIKDIS-FSVNGVRVQLDNIRVDKACGPDAVPARVLKEAATELAPIL 568

Query: 71   TDIFNFSFTSSNFPDSWKPA 12
            T +F  S      P  WK A
Sbjct: 569  TLLFEQSMKDGVLPTVWKDA 588


>SB_51284| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 603

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 13/52 (25%), Positives = 30/52 (57%)
 Frame = -3

Query: 692 WSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLM 537
           W  +LE +++N+ V +    +    ++  P++ VR+  +   W+TP +K+L+
Sbjct: 246 WDSVLESNDVNEAVRNLENLIHDNLEKCMPLKTVRMSSRDPLWMTPLVKSLL 297


>SB_47464| Best HMM Match : RVT_1 (HMM E-Value=0.012)
          Length = 558

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 1/89 (1%)
 Frame = -3

Query: 281 PVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSIS-STAVGIDNVCSKMI 105
           P    D   T  +L + S + P     EL PV+   V     S+    A G D +  K++
Sbjct: 460 PDDFMDHPSTIRILDVCSNTTP---CRELRPVTEGQVLKELHSLKPGKAAGCDAIPPKLL 516

Query: 104 ALILPTVAPILTDIFNFSFTSSNFPDSWK 18
            +    +A  LT +FN    S  +P SWK
Sbjct: 517 KIGETELAKPLTSLFNSCIKSKVWPGSWK 545


>SB_35000| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 185

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 15/43 (34%), Positives = 25/43 (58%)
 Frame = -3

Query: 140 AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           A GID + ++++ +  P +AP +  + N S +S  FP  WK A
Sbjct: 8   AFGIDKISARLLRI--PAIAPSIAKLINLSLSSGTFPKRWKLA 48


>SB_20248| Best HMM Match : GPS (HMM E-Value=1.5)
          Length = 555

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 36/163 (22%), Positives = 70/163 (42%), Gaps = 11/163 (6%)
 Frame = -3

Query: 461 RNRCNRLCRDAKRLYFHKSLENRSPAHT---WRFLKSVGIGKT-------PVSSVKDTD- 315
           RN+  RL +  KR ++ + +E    ++    W+ +K++  G          +    D+D 
Sbjct: 316 RNKVQRLIKSCKRTFYERKVEALKESNISRWWKEVKALSGGSCRNGKWYDQLLVTSDSDP 375

Query: 314 LCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAV 135
           L +L    +   V L+ +    T   ++S  V  +P   L+ +   +   S   I   A 
Sbjct: 376 LESLCNRMNSFFVGLTYNLPPLTTRDVASFQVDEVPARLLATIPDVEYALSATKIKK-AP 434

Query: 134 GIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPAAA 6
           G D + + ++      +AP++ D++N S T   FP   + A A
Sbjct: 435 GPDGIPNTILKTFSFELAPVICDLYNSSLTDGFFPSPVESAIA 477


>SB_16854| Best HMM Match : UL97 (HMM E-Value=4.9)
          Length = 311

 Score = 36.7 bits (81), Expect = 0.020
 Identities = 26/132 (19%), Positives = 55/132 (41%), Gaps = 3/132 (2%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           RN +  +L A  R + +  W+ IL      +    F   + +  + + P++RV++     
Sbjct: 112 RNLRRSNLDAFGRWITHFCWNTILSLQTAREKFERFYTVITNAVNTYLPLQRVQVCATNK 171

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK---SLE 399
           PW+   + +L+                    +YK LRN+  R C+  +  Y+     +L+
Sbjct: 172 PWIGTSLCSLIARRQKALTTL-----SKDSRLYKELRNQVQRECKVCRERYYSNKVAALK 226

Query: 398 NRSPAHTWRFLK 363
             + +  W+ +K
Sbjct: 227 ESNISRWWQEVK 238


>SB_46086| Best HMM Match : RVT_1 (HMM E-Value=1.6e-20)
          Length = 723

 Score = 36.3 bits (80), Expect = 0.027
 Identities = 40/214 (18%), Positives = 81/214 (37%), Gaps = 3/214 (1%)
 Frame = -3

Query: 644 FNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKA 465
           F+  +   F+ + P   +       PW+T  IK  +               ++S A +  
Sbjct: 219 FHSTLTEAFNNYFPTNTIHASLSDKPWMTHQIKHAISKRQRAFSRG----VKNSPAFH-L 273

Query: 464 LRNRCNRLCRDAKRLYFHKSLENRSPAHT---WRFLKSVGIGKTPVSSVKDTDLCALNKH 294
            RN+  RL +  K  ++ + +E    ++    W+ +K++  G        D  L   +  
Sbjct: 274 WRNKVQRLIKSCKGTFYERKVEALKESNISRWWKEVKALSGGSCRNGKWYDQLLVTSDSD 333

Query: 293 FSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCS 114
                 +  +S        +  L+   +  F++  V  A +  +   I   A G D + +
Sbjct: 334 PIESLCNRINSFFVGLTYDLPPLTTRDVASFQVDEVP-ARLLATIPEIKKKAPGPDGIPN 392

Query: 113 KMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
            ++      +AP++ D++N S T   FP   K A
Sbjct: 393 TILKTFAFELAPVICDLYNSSLTDGFFPSLLKSA 426


>SB_37654| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 865

 Score = 36.3 bits (80), Expect = 0.027
 Identities = 29/111 (26%), Positives = 46/111 (41%), Gaps = 2/111 (1%)
 Frame = -3

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRS 390
           PW++P IK LM           R   E  +  Y+ +RN   +  RD   +Y  + L   +
Sbjct: 436 PWVSPAIKRLMRKRDRAYKKAKRSSKEKDIRSYRRIRNYTTKCIRDTHNIYLSEVLGGLA 495

Query: 389 PAHTWRFLKSVGIGKTPVSSVK--DTDLCALNKHFSLPPVSLSDSSKTATL 243
           P  +     + G  K   S +K   ++   +   F +  +S SDSSK   L
Sbjct: 496 PDPS---TPNPGGAKRAWSYLKLLRSESLGIPTLFQVDQISASDSSKAEAL 543


>SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19)
          Length = 674

 Score = 36.3 bits (80), Expect = 0.027
 Identities = 31/122 (25%), Positives = 55/122 (45%), Gaps = 6/122 (4%)
 Frame = -3

Query: 359 VGIGKTPVSSVKDTDLCALNKHFSLP-PVSLSDSSKTATLLKISSLSVPRIPIFELSPVS 183
           VG      +  ++ +L  L + F LP P+  + S+  A L ++    +  +P     P  
Sbjct: 77  VGFDSFSSTKTQEKNLFPLPRAFFLPLPLRSALSNMAAGLCELHVFGI-FLPEKLSKPTG 135

Query: 182 VADVR----NSFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
            ++++    N+  S+    A G+D +    +  + P +   LT IFN S +S  F D WK
Sbjct: 136 YSELKDFVLNNLSSLDIGKAAGLDELNGFFLKSVAPEIFRSLTKIFNLSVSSCVFSDPWK 195

Query: 17  PA 12
            A
Sbjct: 196 RA 197


>SB_25564| Best HMM Match : RVT_1 (HMM E-Value=0.049)
          Length = 588

 Score = 36.3 bits (80), Expect = 0.027
 Identities = 45/225 (20%), Positives = 84/225 (37%), Gaps = 16/225 (7%)
 Frame = -3

Query: 644 FNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIK-TLMXXXXXXXXXXXRCPTEHSLAIYK 468
           F+  +   F+++ P+  +       PW+T  IK  +              P  H      
Sbjct: 68  FHSTLTEAFNKYFPINTIHASPSDKPWITHRIKHAISKRQRAFSRGGKGSPAFH------ 121

Query: 467 ALRNRCNRLCRDAKRLYFHKSLENRSPAHT---WRFLKSVGIGKTPVSSVKDT------- 318
             R +  RL +  KR ++ + +E    ++    W+ +K++  G        D        
Sbjct: 122 LWRKKVQRLIKSCKRTFYERKVEALKESNISRWWKEVKALSGGSCRNGKWYDQLLVTSDS 181

Query: 317 ----DLCA-LNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFS 153
                LC+ +N  F    V L+      T   ++S  V  +P   L+ +   +   S   
Sbjct: 182 NPLESLCSRMNSFF----VGLTYDLPPLTTRDVASFQVDEVPARLLATIPEVERALSATK 237

Query: 152 ISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWK 18
           I   A G D + + ++      +AP++ D++N S T   FP   K
Sbjct: 238 IKK-APGPDGIPNTILKTFAFKLAPVICDLYNSSLTDGFFPSLLK 281


>SB_33292| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 896

 Score = 35.9 bits (79), Expect = 0.035
 Identities = 28/123 (22%), Positives = 51/123 (41%), Gaps = 1/123 (0%)
 Frame = -3

Query: 722 ALRRDVNNTDWSCILEH-HNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIK 546
           AL R + + DWS +     + + M N+F   V +  D   P +   I    APW+TP +K
Sbjct: 331 ALGRYLISIDWSLLFAPLSDCDQMWNTFIEVVSTGLDIIMPEKEYHICAADAPWMTPGLK 390

Query: 545 TLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFL 366
           +++             P       ++ + NR  ++C+        K L+  +P   W  +
Sbjct: 391 SIILKRQEAFKNHG--PESVQFKFFRNMVNRERKVCKSRFYDSKVKQLKGENPKKWWDEV 448

Query: 365 KSV 357
           K +
Sbjct: 449 KQL 451


>SB_27297| Best HMM Match : Bin3 (HMM E-Value=0.074)
          Length = 269

 Score = 35.9 bits (79), Expect = 0.035
 Identities = 51/217 (23%), Positives = 84/217 (38%), Gaps = 16/217 (7%)
 Frame = -3

Query: 614 QHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCR 435
           +H PV+ V+ + K  PW    ++ L            +  T  + + Y+  R    +   
Sbjct: 2   KHYPVKLVKPQQKN-PWFDRTLRRLTRKKQRLFKLAKKVNTPQAWSAYRKHRKVTTQAIN 60

Query: 434 DAKRLYFHKSLENR---SPAHTWRFLKS-----VGIGKTPVSSV----KDTDLCALNKHF 291
             +  Y    L+      P   W ++KS     VGI    V++V          ALN +F
Sbjct: 61  KTRNNYVSGLLDENIHTKPKRFWNYIKSKRQDSVGIPALKVNNVIVSESKAKAEALNNYF 120

Query: 290 SLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSIS----STAVGIDN 123
               V   DS   A     S    P+  I  L  ++V  V  +   I     + A G D 
Sbjct: 121 K--SVFCRDSPDNA-----SPNLPPKDNITPLGNITVT-VNGAIKLIDKLKPNKACGPDK 172

Query: 122 VCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           V ++++ L    V+ +L +IF  S  + + PD W+ A
Sbjct: 173 VSARILKLAPTEVSVVLREIFQQSLDTGDIPDDWRHA 209


>SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8)
          Length = 339

 Score = 35.9 bits (79), Expect = 0.035
 Identities = 51/230 (22%), Positives = 95/230 (41%), Gaps = 8/230 (3%)
 Frame = -3

Query: 677 EHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRC 498
           E  ++    + F   ++S  ++H P +  + K    PW++P IK LM           R 
Sbjct: 22  ESRSVESNWSHFKNGLLSAVEKHVPSKLTKSKLS-LPWMSPTIKRLMRKRDSLLLRAKRS 80

Query: 497 PTEHSLA--IYKALRNRCNRLCRDAKRLYFH----KSLENRSPAHTWRFLKSVGIGKTPV 336
             + S     Y+  RN+  +  + A   Y +    +SL++  P   WR++K         
Sbjct: 81  NNKSSEVWRAYRQQRNKVVKALKVAHNNYLNDVIGESLQS-DPKKFWRYVKR-------- 131

Query: 335 SSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIP-IFELSPVSVADVRNSF 159
                    + +++  +P +    +S    L  +S+ S P I  I    P     +R   
Sbjct: 132 ---------SRSENVGIPTLQRF-TSDNGQLPDLSTSSYPTIKDIIFTEP----GIRKQL 177

Query: 158 FSIS-STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
            S++ S +VG D +  +++  +   ++ +LT IF  SF S   P+ W  A
Sbjct: 178 ESLNPSKSVGPDGLSPRILRDLSSEISNVLTFIFQQSFDSGILPEDWLKA 227


>SB_11125| Best HMM Match : Borrelia_orfA (HMM E-Value=2.7)
          Length = 547

 Score = 35.9 bits (79), Expect = 0.035
 Identities = 53/223 (23%), Positives = 87/223 (39%), Gaps = 15/223 (6%)
 Frame = -3

Query: 635 KVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIY----K 468
           K+ SL +++ P +    ++   PW T ++K L            R   E     +    K
Sbjct: 221 KLSSLMEEYIPAKMSSSRYN-LPWFTHNLKKLKRKVQRLYNTQKRTGLESDKRKFRQTRK 279

Query: 467 ALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKS-----VGIG------KTPVSSVKD 321
           A R + N+   D        S +   P   WRF+KS     +GI          VS+  D
Sbjct: 280 AYRYKLNKQYGDYINNLLGSS-QREQPKKFWRFVKSKRQDNMGINLLHNQHNIAVSNSLD 338

Query: 320 TDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISST 141
                +   FS   +   + S TA  L  +S S P +    ++   V  + NS  S  + 
Sbjct: 339 KANVLIGYFFS---IFTKEDSSTAPSLNPNSSS-PEMGKIIVTSNGVQKLLNSLDS--NK 392

Query: 140 AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           A G D + ++++  +   +AP+ T +F  S      P  WK A
Sbjct: 393 AGGPDKLLTRILKELSQELAPLYTQLFQQSLDQGKLPMDWKIA 435


>SB_40322| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27)
          Length = 710

 Score = 35.9 bits (79), Expect = 0.035
 Identities = 26/132 (19%), Positives = 54/132 (40%), Gaps = 3/132 (2%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           RN +  +L A  R +    W+ IL      +    F   +    + + P++RV++     
Sbjct: 112 RNLRRSNLDAFGRWITQFCWNTILSLQTAREKFERFYTVITDALNTYLPLQRVQVCATNK 171

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK---SLE 399
           PW+   + +L+           +        +YK LRN+  R C+  +  Y+     +L+
Sbjct: 172 PWIGTSLCSLIARRQKALTTLGK-----DSRLYKELRNQVQRECKVCRERYYSNKVAALK 226

Query: 398 NRSPAHTWRFLK 363
             + +  W+ +K
Sbjct: 227 ESNISRWWQEVK 238


>SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 913

 Score = 35.9 bits (79), Expect = 0.035
 Identities = 53/223 (23%), Positives = 87/223 (39%), Gaps = 15/223 (6%)
 Frame = -3

Query: 635  KVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIY----K 468
            K+ SL +++ P +    ++   PW T ++K L            R   E     +    K
Sbjct: 460  KLSSLMEEYIPAKMSSSRYN-LPWFTHNLKKLKRKVQRLYNTQKRTGLESDKRKFRQTRK 518

Query: 467  ALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKS-----VGIG------KTPVSSVKD 321
            A R + N+   D        S +   P   WRF+KS     +GI          VS+  D
Sbjct: 519  AYRYKLNKQYGDYINNLLGSS-QREQPKKFWRFVKSKRQDNMGINLLHNQHNIAVSNSLD 577

Query: 320  TDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISST 141
                 +   FS   +   + S TA  L  +S S P +    ++   V  + NS  S  + 
Sbjct: 578  KANVLIGYFFS---IFTKEDSSTAPSLNPNSSS-PEMGKIIVTSNGVQKLLNSLDS--NK 631

Query: 140  AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
            A G D + ++++  +   +AP+ T +F  S      P  WK A
Sbjct: 632  AGGPDKLLTRILKELSQELAPLYTQLFQQSLDQGKLPMDWKIA 674


>SB_19953| Best HMM Match : Trehalase (HMM E-Value=0.66)
          Length = 1097

 Score = 35.9 bits (79), Expect = 0.035
 Identities = 43/172 (25%), Positives = 72/172 (41%), Gaps = 18/172 (10%)
 Frame = -3

Query: 473 YKALRNRCNRLCRDAKRLYFHKSLEN---RSPAHTWRFLKSVGIGKTPVSSVKDTDLCAL 303
           Y+ LRNR NR  +  +  Y+   +E+     P+  WR +K +G     +S+ +  D   L
Sbjct: 299 YRKLRNRVNRERKSCRSKYYDAKVEHLKESKPSTWWREVKKLG----GMSAPRSQDPALL 354

Query: 302 NKHFSLPPVS--LSDSSKTATLLKISSLSV--PRIPIFELSP----------VSVADVRN 165
            +H +    +  L + + T     +S ++V  P      L+P          VS   V  
Sbjct: 355 YQHIASGQEAGCLKNIADTINTAFLSPMNVFEPLSEKCHLTPESEEHAYTLQVSQLSVLK 414

Query: 164 SFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
               ++ S A G D +   ++      +   +TDI N SF  +  P SWK A
Sbjct: 415 KLAELNPSKACGPDGMPGWILKENADLLDEPVTDILNCSFKEARLPQSWKDA 466



 Score = 35.9 bits (79), Expect = 0.035
 Identities = 43/172 (25%), Positives = 72/172 (41%), Gaps = 18/172 (10%)
 Frame = -3

Query: 473  YKALRNRCNRLCRDAKRLYFHKSLEN---RSPAHTWRFLKSVGIGKTPVSSVKDTDLCAL 303
            Y+ LRNR NR  +  +  Y+   +E+     P+  WR +K +G     +S+ +  D   L
Sbjct: 603  YRKLRNRVNRERKSCRSKYYDAKVEHLKESKPSTWWREVKKLG----GMSAPRSQDPALL 658

Query: 302  NKHFSLPPVS--LSDSSKTATLLKISSLSV--PRIPIFELSP----------VSVADVRN 165
             +H +    +  L + + T     +S ++V  P      L+P          VS   V  
Sbjct: 659  YQHIASGQEAGCLKNIADTINTAFLSPMNVFEPLSEKCHLTPESEEHAYTLQVSQLSVLK 718

Query: 164  SFFSIS-STAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
                ++ S A G D +   ++      +   +TDI N SF  +  P SWK A
Sbjct: 719  KLAELNPSKACGPDGMPGWILKENADLLDEPVTDILNCSFKEARLPQSWKDA 770


>SB_21896| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 759

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 49/219 (22%), Positives = 88/219 (40%), Gaps = 12/219 (5%)
 Frame = -3

Query: 632 VISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNR 453
           +++ F+   P+++ ++    AP++TP  K L+              T+     ++  RN 
Sbjct: 326 IMTGFNIIMPIKKSKLHVNDAPFVTPQFKKLIHLRQSAF-------TKGDTVRFRHYRNA 378

Query: 452 CNRLCRDAKRLYFHKS----LENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFS- 288
            NR  R A R  F+ S    L++  P+  W  +K +  G  P S   D       + F  
Sbjct: 379 VNRE-RKALRAKFYASKVSHLKDSKPSQWWSNVKRIA-GINPASGSGDLISTLQVEGFDR 436

Query: 287 LPPVSLSDSSKTATL------LKISSLSVPRIPIFELSPVSVADVRNSFFSI-SSTAVGI 129
           L    + +   +A L       ++ SL +P      ++ VS   V  +   +    A G 
Sbjct: 437 LSESDIVNKLNSAFLEPMLPFKRLESLPIPDKVTVSMT-VSEPAVLTALSDLHPGKAAGP 495

Query: 128 DNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           D V + ++      +A  +T + N SF     P +WK A
Sbjct: 496 DGVPNWLLKDYADILASFVTSVLNSSFAEQGLPSAWKMA 534


>SB_2439| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 951

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 26/132 (19%), Positives = 54/132 (40%), Gaps = 3/132 (2%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           RN +  +L A  R +    W+ IL      +    F   +    + + P++RV++     
Sbjct: 455 RNLRRSNLDAFGRWITQFCWNTILSLQTAREKFERFYTVITYAVNTYLPLQRVQVCATNK 514

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHK---SLE 399
           PW+   + +L+           +        +YK LRN+  R C+  +  Y+     +L+
Sbjct: 515 PWIGTSLCSLIARRQKALTTLGK-----DARLYKELRNQVQRECKVCRERYYSNKVAALK 569

Query: 398 NRSPAHTWRFLK 363
             + +  W+ +K
Sbjct: 570 ESNISRLWQEVK 581


>SB_58520| Best HMM Match : RVT_1 (HMM E-Value=0.035)
          Length = 556

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 25/128 (19%), Positives = 51/128 (39%), Gaps = 1/128 (0%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKP- 573
           R  K +D  A   D+  +   C  ++ N  ++ N +N  +  L  +H P++   I  +P 
Sbjct: 100 RKLKSLDREAFTEDIMVSPLFC-KDYTNTEELSNCYNNVLTKLLHKHVPIKTCTITIRPA 158

Query: 572 APWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENR 393
           APW   +I+              +   E    +Y       N+L  D++  ++ + ++  
Sbjct: 159 APWYCDNIRKEKAKRRKLKALWRKTRLEVHRQMYTEQCVHVNKLLYDSRMQFYARIIDEN 218

Query: 392 SPAHTWRF 369
           S +    F
Sbjct: 219 STSQRTLF 226


>SB_50409| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 468

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 16/60 (26%), Positives = 33/60 (55%), Gaps = 1/60 (1%)
 Frame = -3

Query: 188 VSVADVRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           +S+++V+++  S+  T A G + + ++++    P +AP L  +FN   +    P  WK A
Sbjct: 129 ISISEVQSTLESLDVTKATGPNGISTRLLKETAPEIAPSLCKLFNKYLSLEAIPQEWKEA 188


>SB_45260| Best HMM Match : RVT_1 (HMM E-Value=1.2)
          Length = 584

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 33/139 (23%), Positives = 60/139 (43%), Gaps = 2/139 (1%)
 Frame = -3

Query: 428 KRLYFHKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTA 249
           K  ++ K  E+  P     + ++V             DL +LN          +  ++  
Sbjct: 237 KSNFYAKKAEHTQPGDVREWWRTVNTLSGRSKGDPKMDLSSLNLSSVTLNRYFATVAEDI 296

Query: 248 TLLKISSLSVPRIPIFELSP-VSVADVRNSFFSISST-AVGIDNVCSKMIALILPTVAPI 75
             L +S+L    +P  + +P V +  VR    ++ +  A+G DN+ +++I      +A  
Sbjct: 297 APLNLSALP-SYLPSSKPTPIVQMHVVRKKLLNVQTIKAMGPDNIPARIIKEFSYELAQP 355

Query: 74  LTDIFNFSFTSSNFPDSWK 18
           +T+IFN SF S   P  WK
Sbjct: 356 VTEIFNRSFCSGELPTIWK 374


>SB_3341| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 552

 Score = 35.5 bits (78), Expect = 0.047
 Identities = 21/69 (30%), Positives = 40/69 (57%), Gaps = 2/69 (2%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRR--VRIKHK 576
           R  + +D+  L  D+ N++     +  NIN++V  ++  + +L D+HAP++   V I+ K
Sbjct: 268 RKLRSVDIDQLSEDLLNSELFQN-QQVNINNLVIKYDSTLKALLDKHAPLKAKLVTIRLK 326

Query: 575 PAPWLTPDI 549
            A W TP++
Sbjct: 327 -AAWYTPEV 334


>SB_58998| Best HMM Match : PkinA_anch (HMM E-Value=1.8)
          Length = 301

 Score = 35.1 bits (77), Expect = 0.062
 Identities = 18/56 (32%), Positives = 25/56 (44%)
 Frame = -3

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSL 402
           PW++P IK LM           R   E  L  Y+ +RN   +  RD   +YF + L
Sbjct: 245 PWVSPAIKRLMRKRDRAYKKAKRSSKEKDLRSYRRIRNYTTKCIRDTHNIYFSEVL 300


>SB_54431| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1023

 Score = 35.1 bits (77), Expect = 0.062
 Identities = 24/110 (21%), Positives = 45/110 (40%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPA 570
           RN +  +L A  R +    W+ IL      +    F   +    + + P++RV++     
Sbjct: 502 RNLRRSNLDAFGRWITQFCWNTILSLQTAREKFERFFTVITDAVNTYLPLQRVQVCATNK 561

Query: 569 PWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLCRDAKRL 420
           PW+   + +L+           +        +YK LRN+  R C++ K L
Sbjct: 562 PWIGTSLCSLIARRQKALTTLGK-----DSRLYKELRNQVQRECKEVKCL 606


>SB_32586| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 462

 Score = 35.1 bits (77), Expect = 0.062
 Identities = 16/58 (27%), Positives = 30/58 (51%)
 Frame = -3

Query: 749 RNYKGIDLGALRRDVNNTDWSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHK 576
           R+YK  +     RD+    +  +    N ++ VN+FN       + HAP++R++IK +
Sbjct: 77  RSYKNYNPEHFLRDLEYVPFLIVNVFENFDNQVNAFNDLFSDTLELHAPLKRIKIKSR 134


>SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 968

 Score = 35.1 bits (77), Expect = 0.062
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = -3

Query: 149 SSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           +S A G DN+  +++      +AP L  IFN S     FP  WK A
Sbjct: 477 ASKASGPDNIPVRLLKETAAVIAPSLCQIFNKSIKLGKFPSEWKIA 522


>SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14)
          Length = 832

 Score = 35.1 bits (77), Expect = 0.062
 Identities = 48/219 (21%), Positives = 85/219 (38%), Gaps = 11/219 (5%)
 Frame = -3

Query: 635 KVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIY----K 468
           K+ SL +++ P +    ++   PW T ++K L            R   E     +    K
Sbjct: 221 KLSSLMEEYIPAKMSSSRYN-LPWFTHNLKKLKRKVQRLYNTQKRTGLESDKRKFRQTRK 279

Query: 467 ALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFS 288
           A R + N+   D        S +   P   WRF+KS       ++ + +    A++   S
Sbjct: 280 AYRYKLNKSYGDYINNLLGSS-QREQPKKFWRFVKSKRQDNMGINLLHNQHNIAVSN--S 336

Query: 287 LPPVSLSDSSKTATLLKISSLSVPRIPIFELSP------VSVADVRNSFFSISST-AVGI 129
           L   ++ +    +   K  S + P +     SP      V+   V+    SI S  A G 
Sbjct: 337 LDKANVLNGYFFSIFTKEDSSTAPSLNPNSSSPEMGKIIVTSNGVQKLLNSIDSNKAGGP 396

Query: 128 DNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
           D + ++++  +   +AP+ T +F  S      P  WK A
Sbjct: 397 DKLPTRILKELSQELAPLYTQLFQQSLDQGKLPMDWKIA 435


>SB_24103| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 35.1 bits (77), Expect = 0.062
 Identities = 30/100 (30%), Positives = 45/100 (45%), Gaps = 2/100 (2%)
 Frame = -3

Query: 305 LNKHFSLPPVSLSDS-SKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSI-SSTAVG 132
           LN+HF     + SD  + +  LLK     +P I + E        VR     + SS A G
Sbjct: 22  LNQHFR---ENFSDEDTDSIPLLKRRFPQIPSIAVTE------EGVRKLLAGLKSSKAAG 72

Query: 131 IDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
            D+   +++    P ++PIL  IF  S  + N P  W+ A
Sbjct: 73  PDSFHPRVLKECAPVISPILKQIFQKSLDAGNLPREWRIA 112


>SB_23376| Best HMM Match : GPS (HMM E-Value=1.2)
          Length = 368

 Score = 35.1 bits (77), Expect = 0.062
 Identities = 44/224 (19%), Positives = 85/224 (37%), Gaps = 11/224 (4%)
 Frame = -3

Query: 644 FNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKA 465
           F+  +   F+++ P+  +       PW+T  I                 P  H       
Sbjct: 11  FHSTLTEAFNKYFPINIIHASPSDKPWITHAISKRQRAFSRGGKGS---PAFH------L 61

Query: 464 LRNRCNRLCRDAKRLYFHKSLENRSPAHT---WRFLKSVGIGKT-------PVSSVKDTD 315
            RN+  RL +  KR ++ + +E    ++    W+ +K++  G          +    D+D
Sbjct: 62  WRNKVQRLIKSCKRTFYERKVEALKESNISRWWKEVKALSGGSCRNGKWYDQLLVTSDSD 121

Query: 314 -LCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTA 138
            L +L    +   V L+      T   ++S  V  +P   L+ +   +   S   I    
Sbjct: 122 PLESLCNRMNSFFVGLTYDLPPLTTRDVASFQVDEVPARLLATIPEVERALSATKIKKEP 181

Query: 137 VGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPAAA 6
            G D + + ++      +AP++ +++N S T   FP   K A A
Sbjct: 182 -GPDGIPNTILKTFSFELAPVICELYNSSLTDGFFPSPLKSAIA 224


>SB_57968| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 220

 Score = 34.7 bits (76), Expect = 0.082
 Identities = 20/70 (28%), Positives = 35/70 (50%)
 Frame = -3

Query: 221 VPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTS 42
           VPR+  F+L  ++  DVR    +   T+  +D + + ++      +  ++T + N S  S
Sbjct: 92  VPRMEAFKL--LTEEDVRMLIKNPKCTSCCLDPIPTHLLKSCSEPLVSVITKLINNSLES 149

Query: 41  SNFPDSWKPA 12
             FPD WK A
Sbjct: 150 GIFPDCWKEA 159


>SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05)
          Length = 790

 Score = 34.7 bits (76), Expect = 0.082
 Identities = 47/219 (21%), Positives = 85/219 (38%), Gaps = 11/219 (5%)
 Frame = -3

Query: 635  KVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIY----K 468
            K+ SL +++ P +    ++   PW T ++K L            R   E     +    K
Sbjct: 477  KLSSLMEEYIPAKMSSSRYN-LPWFTHNLKKLKRKVQRLYNTQKRTGLESDKGKFRQTRK 535

Query: 467  ALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFS 288
            A R + N+   D        S +   P   WRF+KS       ++ + +    A++   S
Sbjct: 536  AYRYKLNKSYGDYINNLLGSS-QREQPKKFWRFVKSKRQDNMGINLLHNQHNIAVSN--S 592

Query: 287  LPPVSLSDSSKTATLLKISSLSVPRIPIFELSP------VSVADVRNSFFSISST-AVGI 129
            L   ++ +    +   K  S + P +     SP      V+   V+    S+ S  A G 
Sbjct: 593  LDKANVLNGYFFSIFTKEDSSTAPSLNPNSSSPEMGKIIVTSNGVQKLLNSLDSNKAGGP 652

Query: 128  DNVCSKMIALILPTVAPILTDIFNFSFTSSNFPDSWKPA 12
            D + ++++  +   +AP+ T +F  S      P  WK A
Sbjct: 653  DKLPTRILKELSQELAPLYTQLFQQSLDQGKLPMDWKIA 691


>SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36)
          Length = 449

 Score = 34.7 bits (76), Expect = 0.082
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 1/63 (1%)
 Frame = -3

Query: 203 FELSPVSVADVRNSFFSISST-AVGIDNVCSKMIALILPTVAPILTDIFNFSFTSSNFPD 27
           F+L  +S   V     ++  T A G+D +  +++      + P LT++ N S  +  +PD
Sbjct: 142 FQLHKISYTRVLELLQNLGPTKATGLDCISCRLLKESADILCPSLTNLINLSIHTGLYPD 201

Query: 26  SWK 18
            WK
Sbjct: 202 KWK 204


>SB_4188| Best HMM Match : 7tm_1 (HMM E-Value=9e-06)
          Length = 522

 Score = 34.7 bits (76), Expect = 0.082
 Identities = 28/101 (27%), Positives = 46/101 (45%), Gaps = 8/101 (7%)
 Frame = -3

Query: 290 SLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVADVRNSFFSISSTAV------GI 129
           S  P ++ ++ K +  +  + LSV    + E S   + +V N+F+     A         
Sbjct: 334 SKTPKAVLEAFKKSNWINKTCLSVKDSYMRETSK-DLLEVANAFYEFFVNAAFKHRTGPT 392

Query: 128 DNVCSKMIALIL--PTVAPILTDIFNFSFTSSNFPDSWKPA 12
           +N C + +   +  P +A  LT I N S   S FP +WKPA
Sbjct: 393 ENSCFERLKSFVNAPVIAAPLTKIINLSICKSVFPTTWKPA 433


>SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 947

 Score = 34.7 bits (76), Expect = 0.082
 Identities = 20/112 (17%), Positives = 46/112 (41%)
 Frame = -3

Query: 692 WSCILEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXX 513
           W+ + +   +++   +F+  +    D++ P+R++ I     PW++  +K L+        
Sbjct: 87  WTEVFDKQLVSEKFQAFSDVLYMAVDKYLPLRKISICSSDKPWVSNKLKYLVSKRQKALH 146

Query: 512 XXXRCPTEHSLAIYKALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSV 357
                  +     +K  RN     C+ +K  Y+   + N    +  R+ K V
Sbjct: 147 QFGNDSPQ-----FKMYRNSVQEECKKSKASYYKTKVANTKNTNVKRWWKEV 193


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,956,162
Number of Sequences: 59808
Number of extensions: 482168
Number of successful extensions: 2359
Number of sequences better than 10.0: 380
Number of HSP's better than 10.0 without gapping: 2125
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2280
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 2046258890
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).