SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0034
         (840 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_26663| Best HMM Match : Telo_bind (HMM E-Value=1.8e-17)             35   0.071
SB_22648| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.12 
SB_26106| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.53)           31   1.2  
SB_48894| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.2  
SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.6  
SB_16796| Best HMM Match : Multi_Drug_Res (HMM E-Value=0.96)           29   4.7  
SB_14763| Best HMM Match : Zona_pellucida (HMM E-Value=0)              29   4.7  
SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.2  
SB_12390| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.2  
SB_26832| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.2  
SB_1010| Best HMM Match : Spt4 (HMM E-Value=6.9)                       29   6.2  
SB_35730| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.2  
SB_32406| Best HMM Match : VWA (HMM E-Value=8.8e-32)                   28   8.2  
SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0)                      28   8.2  
SB_32904| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.2  
SB_27684| Best HMM Match : DUF1660 (HMM E-Value=3.8)                   28   8.2  

>SB_26663| Best HMM Match : Telo_bind (HMM E-Value=1.8e-17)
          Length = 1086

 Score = 35.1 bits (77), Expect = 0.071
 Identities = 16/41 (39%), Positives = 26/41 (63%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANIT 459
           P  S T+CG  AT+T+S I+  A+++  +T   +SS  N+T
Sbjct: 730 PTVSTTTCGAAATKTTSAISQGASTSLQATTHSVSSPTNVT 770


>SB_22648| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 27/74 (36%), Positives = 36/74 (48%)
 Frame = -2

Query: 554 TRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKTTPAT 375
           T +T TS+  TS   S + ST    S++ + T   +N   T  STTT+    T  TT  T
Sbjct: 16  TTSTTTSTTNTSTTTSTTTSTTN-TSTTTSTTTSTTNTSTT-TSTTTS-TTNTSTTTSTT 72

Query: 374 MSAGNSSLFGKTTT 333
            S  N+S    TTT
Sbjct: 73  TSTTNTSTTTSTTT 86


>SB_26106| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.53)
          Length = 291

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 13/46 (28%), Positives = 28/46 (60%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWML 435
           S+T  GT    T+   T++ ++  Y+T + +++ +  T+K +NW+L
Sbjct: 241 SKTQHGTTQHSTTQHSTTQYSTTQYNTTQHVTTRSASTVKHNNWLL 286


>SB_48894| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 11/37 (29%), Positives = 20/37 (54%)
 Frame = +2

Query: 293 KYISYSVFSILNITLLSSQREMSCQLTWWLV*SFPSP 403
           +YI   + +   ++  +S   + CQ+ WWL   +PSP
Sbjct: 36  QYIGLQLLASSGVSSRASDIHIGCQIVWWLDDRYPSP 72


>SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 414

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 30/90 (33%), Positives = 39/90 (43%), Gaps = 6/90 (6%)
 Frame = -3

Query: 334 RDIQDTEHRIRDVL-ETGRERGQLRRQEDLGIEWFQ*EETHLVFIPGKGGRPTAVPHR-E 161
           RD QD    ++ +  E+G+ +    R   L IE+ Q +E+      G GG P   P R  
Sbjct: 25  RDEQDAADAMKQMGGESGKGKEIFGRA--LNIEYAQEKESSAPRRGGYGGGPPRGPPRGH 82

Query: 160 P----GVPAGTEAGRERGLIRGPPCVGEQR 83
           P    G P G      RG  RGPP  G  R
Sbjct: 83  PMRGRGAPYGRGGPPSRGPPRGPPLPGPPR 112


>SB_16796| Best HMM Match : Multi_Drug_Res (HMM E-Value=0.96)
          Length = 725

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 18/62 (29%), Positives = 34/62 (54%)
 Frame = -2

Query: 569 RTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEK 390
           R+  G+RA+R +   T R + ++ + N  L S+ +++ + S+    LAST  + PG  + 
Sbjct: 269 RSRPGSRASRVTPLSTPRLSRHTRAHNLPLGSNFSLSRRASHGPSPLASTVLSLPGTQDY 328

Query: 389 TT 384
            T
Sbjct: 329 LT 330


>SB_14763| Best HMM Match : Zona_pellucida (HMM E-Value=0)
          Length = 689

 Score = 29.1 bits (62), Expect = 4.7
 Identities = 24/68 (35%), Positives = 35/68 (51%)
 Frame = -2

Query: 536 SSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKTTPATMSAGNS 357
           +S   S +NSNS S +   S+S + +   SN  +T A+TTT     T  T  AT +A  +
Sbjct: 391 NSNSNSNSNSNSNSNSNSNSNSNSNSNSNSNSTVT-ATTTTTVTVTTTATATATATATAT 449

Query: 356 SLFGKTTT 333
           +    TTT
Sbjct: 450 ATATVTTT 457


>SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1069

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 22/77 (28%), Positives = 32/77 (41%), Gaps = 1/77 (1%)
 Frame = -2

Query: 563 SCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*P-GETEKT 387
           S G+    +S+  T     +S ST      +        N + T  S TT  P G T  T
Sbjct: 138 SSGSTLPTSSTPATQNPTDSSLSTKPPTKKTGETQSPTENSISTEESATTPTPSGSTSPT 197

Query: 386 TPATMSAGNSSLFGKTT 336
           +P   S  +S+  G+TT
Sbjct: 198 SPNNASPQSSTRPGETT 214



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = -3

Query: 190 GRPTAVPHREPGVPAGTEAGRERGLIRGPP 101
           G+PTA   + PG P G   G   G++   P
Sbjct: 495 GKPTAPTPKPPGSPVGVTQGPTEGVVSAKP 524


>SB_12390| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 868

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 15/44 (34%), Positives = 19/44 (43%)
 Frame = +3

Query: 63  RGCRRLSRCSPTQGGPRMSPRSRPASVPAGTPGSR*GTAVGLPP 194
           R   + S   P+ G P   PR RP   P   PG+R G    + P
Sbjct: 163 RNLHKASGGGPSLGAPGGRPRIRPEIRPGARPGARPGARPRVRP 206


>SB_26832| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 635

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 22/58 (37%), Positives = 26/58 (44%)
 Frame = +3

Query: 30  TATAGL*SRSTRGCRRLSRCSPTQGGPRMSPRSRPASVPAGTPGSR*GTAVGLPPLPG 203
           T++A L  R  +G R   R  P   GP   P  R    P G PG    T +GLP  PG
Sbjct: 459 TSSATLGGRGPQGVRG-DRGPPGPAGPP-GPSGRYVPGPPGPPGR---TVIGLPGPPG 511


>SB_1010| Best HMM Match : Spt4 (HMM E-Value=6.9)
          Length = 99

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = -1

Query: 291 KLDVNVDSYGDRKTWGSNGSSEKRHTWSLYPVKVGDQQ 178
           K+ +N  S+   +TW  N    KR    +YP++ G +Q
Sbjct: 31  KVKLNPGSWACEETWQKNSKDIKRAIKGIYPMEEGPKQ 68


>SB_35730| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 266

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 17/73 (23%), Positives = 44/73 (60%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S +S  + ++ +SS  +S ++S+S S++   SSS++ +   S+   + +S++++    + 
Sbjct: 94  SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 153

Query: 392 KTTPATMSAGNSS 354
            ++ ++ S+ NSS
Sbjct: 154 SSSSSSSSSSNSS 166



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 17/73 (23%), Positives = 44/73 (60%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S +S  + ++ +SS  +S ++SNS S++   SSS++ +   S+   + +S++++    + 
Sbjct: 142 SSSSSSSSSSSSSSSSSSSSSSNSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 201

Query: 392 KTTPATMSAGNSS 354
            ++ ++ S+ +SS
Sbjct: 202 SSSSSSSSSSSSS 214


>SB_32406| Best HMM Match : VWA (HMM E-Value=8.8e-32)
          Length = 1074

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 2/35 (5%)
 Frame = +3

Query: 108 PRMSPRSRPASVPAGTPGSR*GTAVG-LPP-LPGI 206
           P   P  RP  +P  TPG R G   G +PP +PG+
Sbjct: 509 PGRRPGWRPGGIPGRTPGRRPGGRPGNIPPFVPGL 543


>SB_20851| Best HMM Match : Cbl_N3 (HMM E-Value=0)
          Length = 695

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 14/27 (51%), Positives = 17/27 (62%)
 Frame = +3

Query: 84  RCSPTQGGPRMSPRSRPASVPAGTPGS 164
           R SP +  PR SPRS P + P G+P S
Sbjct: 341 RPSP-KNSPRTSPRSSPFASPTGSPTS 366


>SB_32904| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 477

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 20/71 (28%), Positives = 36/71 (50%)
 Frame = -2

Query: 566 TSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKT 387
           TS  +  +  SS  +S +NSNS S++   SSS++ +   SN      S +++    +  +
Sbjct: 116 TSSSSSNSSRSSSSSSNSNSNSSSSSSSSSSSSSGSSSSSNSNSNSNSNSSSSSNSSSNS 175

Query: 386 TPATMSAGNSS 354
              + S+ NSS
Sbjct: 176 NSNSSSSSNSS 186


>SB_27684| Best HMM Match : DUF1660 (HMM E-Value=3.8)
          Length = 398

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 18/48 (37%), Positives = 21/48 (43%)
 Frame = -3

Query: 187 RPTAVPHREPGVPAGTEAGRERGLIRGPPCVGEQRDSRRQPRVLRLHN 44
           RP    HR  GV    E   E G   G P  G   D++R P V R H+
Sbjct: 99  RPLPRKHRHEGVSGDRENTEEDGGANGSPRGG--GDTKRPPYVTRRHS 144


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,938,526
Number of Sequences: 59808
Number of extensions: 523775
Number of successful extensions: 1757
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 1512
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1746
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2371447782
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).