SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0033
         (887 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_51467| Best HMM Match : No HMM Matches (HMM E-Value=.)             113   2e-25
SB_40642| Best HMM Match : Sod_Fe_N (HMM E-Value=3.8e-10)              95   7e-20
SB_23784| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.0  
SB_14229| Best HMM Match : VAR1 (HMM E-Value=5)                        29   5.0  
SB_36751| Best HMM Match : Exo_endo_phos (HMM E-Value=2e-12)           29   6.6  
SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042)                 29   6.6  

>SB_51467| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 465

 Score =  113 bits (272), Expect = 2e-25
 Identities = 65/211 (30%), Positives = 109/211 (51%), Gaps = 17/211 (8%)
 Frame = +3

Query: 144 QKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDI--DTI 317
           +K+TLPELPY+YN LEP I    + +HH  HHA Y   LN A ++  ++  + D+   +I
Sbjct: 245 EKYTLPELPYDYNELEPHIDEATLRVHHLGHHAAYTKKLNAALKEWRESGKEKDLASKSI 304

Query: 318 INLA-----------PALKFNGGGHINHSIFWHNLSPNGGK----PSDVLTKAVEKDFGS 452
           + +              +  NGGG +NH+++W  +SPN       P+  +   ++K  G+
Sbjct: 305 VEILRNNEQIPDKWRTDVINNGGGFVNHALYWATMSPNPKSEPRTPTGKIGDLIDKSHGN 364

Query: 453 WDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEH 632
           +   K        ++ GSG+ WL  +     L I    NQ+   A   L P+  ID+WEH
Sbjct: 365 FSMFKQWFDEQVNSMFGSGYTWLCQDVTSGFLTILNMGNQESPVAYR-LNPVLVIDLWEH 423

Query: 633 AYYLQYKNVRADYVKAIFDVANWNDISQRYE 725
           A+YL+++N R  YV + + + +W  +++  E
Sbjct: 424 AFYLKHQNKRPGYVHSWWHLVDWERVNELLE 454


>SB_40642| Best HMM Match : Sod_Fe_N (HMM E-Value=3.8e-10)
          Length = 75

 Score = 95.1 bits (226), Expect = 7e-20
 Identities = 40/53 (75%), Positives = 47/53 (88%)
 Frame = +3

Query: 141 RQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAK 299
           R KHTLP+LPY+Y+ALEP I+ EIM LHHSKHHATY+NNLN+AEEK  +AQAK
Sbjct: 22  RAKHTLPDLPYDYDALEPTINTEIMRLHHSKHHATYVNNLNIAEEKCLEAQAK 74


>SB_23784| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 390

 Score = 29.1 bits (62), Expect = 5.0
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = -3

Query: 648 TEDSTRAPIHRFRRAGPIQWWPAE 577
           T+D  + P+ RFR  GPIQ  P E
Sbjct: 36  TDDDFKPPLKRFRTPGPIQRIPGE 59


>SB_14229| Best HMM Match : VAR1 (HMM E-Value=5)
          Length = 356

 Score = 29.1 bits (62), Expect = 5.0
 Identities = 11/27 (40%), Positives = 14/27 (51%)
 Frame = +2

Query: 314 HYQPCTSLEIQWWWSHQPLDLLAQPVT 394
           HY      ++ WW SH PLD  A+  T
Sbjct: 18  HYSNHREAQVGWWLSHWPLDTAARART 44


>SB_36751| Best HMM Match : Exo_endo_phos (HMM E-Value=2e-12)
          Length = 906

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = +1

Query: 97  CHKGLDH*FELPVLLARSILCQSFRTSTMHWSRSLAVKS*VFIT 228
           CH+   H +  PV+L+R ++   F TS  H   SL V S V ++
Sbjct: 730 CHQWFCHGWLSPVVLSRVVVTSGFVTSGCHEWLSLVVLSPVVLS 773


>SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042)
          Length = 4607

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +2

Query: 629  ARVLSSVQERSCRLRESYFRCSQLE*YISEI 721
            ARV S V++R   L  S F CS +E Y+ +I
Sbjct: 3054 ARVCSVVEQRIPALLNSSFLCSHIEDYVDDI 3084


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,574,117
Number of Sequences: 59808
Number of extensions: 587038
Number of successful extensions: 1994
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1825
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1991
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2538363813
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).