SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0031
         (644 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_43857| Best HMM Match : MAP1_LC3 (HMM E-Value=0)                   235   2e-62
SB_13547| Best HMM Match : MAP1_LC3 (HMM E-Value=0)                    95   6e-20
SB_52412| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.3  
SB_13733| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.3  
SB_55930| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.7  
SB_40533| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.7  
SB_55747| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.9  
SB_47703| Best HMM Match : GIY-YIG (HMM E-Value=0.56)                  27   9.9  
SB_46172| Best HMM Match : Peptidase_C54 (HMM E-Value=1)               27   9.9  
SB_397| Best HMM Match : MFS_1 (HMM E-Value=0.16)                      27   9.9  
SB_47833| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.9  
SB_39196| Best HMM Match : Phage_GP20 (HMM E-Value=3.9)                27   9.9  
SB_29369| Best HMM Match : GIY-YIG (HMM E-Value=0.56)                  27   9.9  
SB_413| Best HMM Match : Phage_GP20 (HMM E-Value=3.9)                  27   9.9  

>SB_43857| Best HMM Match : MAP1_LC3 (HMM E-Value=0)
          Length = 119

 Score =  235 bits (575), Expect = 2e-62
 Identities = 106/116 (91%), Positives = 114/116 (98%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           MK++YKEEH FEKR+AEGEKIR+KYPDRVPVIVEKAPKAR+GDLDKKKYLVPSDLTVGQF
Sbjct: 1   MKWEYKEEHPFEKRRAEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           YFLIRKRIHLRPEDALFFFVNNVIPPTSATMG LYQEHH+EDFFLYIA+SDE+VYG
Sbjct: 61  YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 116


>SB_13547| Best HMM Match : MAP1_LC3 (HMM E-Value=0)
          Length = 140

 Score = 94.7 bits (225), Expect = 6e-20
 Identities = 48/115 (41%), Positives = 71/115 (61%), Gaps = 2/115 (1%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFL 232
           +K+  SF  R+ E   IR K+P ++PVIVE+  K + L  LDK K+LVP +LT+ QF  +
Sbjct: 14  FKQRKSFVSRRDEVAGIRAKFPSKIPVIVERYHKEKDLPLLDKTKFLVPQELTMSQFVTI 73

Query: 233 IRKRIHLRPEDALFFFVNN-VIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN 394
           IR R+ L    A +  VNN  +   S TM  LY+E  DED FLY+ ++ + ++G+
Sbjct: 74  IRNRMSLSSTQAFYLIVNNKSLASMSMTMAELYREEKDEDGFLYMVYASQEMFGS 128


>SB_52412| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 485

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 1/54 (1%)
 Frame = -2

Query: 385 DIFVGKC-YV*KEIFIMVFLIERPHCCRCGWNDIVHEEEKCVFRPQVNTFPDQE 227
           D+ VG C Y      +   L +RP       +++V ++++ VF+P  +T  DQ+
Sbjct: 132 DLAVGYCQYDHLASVLTQLLTDRPEASTEILDELVRDKKRAVFKPNFDTIQDQQ 185


>SB_13733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1455

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = +2

Query: 125 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLR 256
           RV   + +     + + D K YL P D   G+FY L   +IH+R
Sbjct: 214 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYIL--PKIHIR 255


>SB_55930| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 643

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 17/52 (32%), Positives = 29/52 (55%)
 Frame = -2

Query: 424 NYLKVNNLELISIDIFVGKCYV*KEIFIMVFLIERPHCCRCGWNDIVHEEEK 269
           N L+ NN +L +  +F G C+V K + IM FL+    C R   +  + +++K
Sbjct: 586 NCLEYNNTQL-AYTVF-GLCFVCKLVVIMGFLVSYLSCRRINKSTRLRQDDK 635


>SB_40533| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 319

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 14/46 (30%), Positives = 21/46 (45%)
 Frame = +2

Query: 122 DRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 259
           +RV   + +     + + D K YL P D   G+FY L +   H  P
Sbjct: 81  ERVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 126


>SB_55747| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 228

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 14/45 (31%), Positives = 20/45 (44%)
 Frame = +2

Query: 125 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 259
           RV   + +     + + D K YL P D   G+FY L +   H  P
Sbjct: 158 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 202


>SB_47703| Best HMM Match : GIY-YIG (HMM E-Value=0.56)
          Length = 640

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 14/45 (31%), Positives = 20/45 (44%)
 Frame = +2

Query: 125 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 259
           RV   + +     + + D K YL P D   G+FY L +   H  P
Sbjct: 77  RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 121


>SB_46172| Best HMM Match : Peptidase_C54 (HMM E-Value=1)
          Length = 417

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 14/45 (31%), Positives = 20/45 (44%)
 Frame = +2

Query: 125 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 259
           RV   + +     + + D K YL P D   G+FY L +   H  P
Sbjct: 34  RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 78


>SB_397| Best HMM Match : MFS_1 (HMM E-Value=0.16)
          Length = 394

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 14/45 (31%), Positives = 20/45 (44%)
 Frame = +2

Query: 125 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 259
           RV   + +     + + D K YL P D   G+FY L +   H  P
Sbjct: 324 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 368


>SB_47833| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 302

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 14/45 (31%), Positives = 20/45 (44%)
 Frame = +2

Query: 125 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 259
           RV   + +     + + D K YL P D   G+FY L +   H  P
Sbjct: 232 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 276


>SB_39196| Best HMM Match : Phage_GP20 (HMM E-Value=3.9)
          Length = 201

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 14/45 (31%), Positives = 20/45 (44%)
 Frame = +2

Query: 125 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 259
           RV   + +     + + D K YL P D   G+FY L +   H  P
Sbjct: 131 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 175


>SB_29369| Best HMM Match : GIY-YIG (HMM E-Value=0.56)
          Length = 785

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 14/45 (31%), Positives = 20/45 (44%)
 Frame = +2

Query: 125 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 259
           RV   + +     + + D K YL P D   G+FY L +   H  P
Sbjct: 450 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 494


>SB_413| Best HMM Match : Phage_GP20 (HMM E-Value=3.9)
          Length = 179

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 14/45 (31%), Positives = 20/45 (44%)
 Frame = +2

Query: 125 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 259
           RV   + +     + + D K YL P D   G+FY L +   H  P
Sbjct: 109 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 153


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,591,702
Number of Sequences: 59808
Number of extensions: 377785
Number of successful extensions: 790
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 748
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 788
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1633044375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).