SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0028
         (956 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)              69   4e-12
SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.)              68   1e-11
SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.)              66   5e-11
SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.)              63   4e-10
SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.)              63   4e-10
SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2)              63   4e-10
SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)              61   1e-09
SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   3e-09
SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)              60   3e-09
SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   3e-09
SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)                       60   3e-09
SB_4159| Best HMM Match : Vpu (HMM E-Value=2)                          60   3e-09
SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   3e-09
SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29)             58   1e-08
SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_47291| Best HMM Match : PilN (HMM E-Value=0.75)                     58   1e-08
SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53)           58   1e-08
SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14)                  58   1e-08
SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)                 58   1e-08
SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6)                  58   1e-08
SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11)                     58   1e-08
SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8)                58   1e-08
SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.)               58   1e-08
SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30)             58   1e-08
SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7)                    58   1e-08
SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22)                58   1e-08
SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37)        58   1e-08
SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18)                    58   1e-08
SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_9250| Best HMM Match : BAG (HMM E-Value=6.2)                        58   1e-08
SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4)                  58   1e-08
SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.)                58   1e-08
SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   1e-08
SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)           58   1e-08
SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)               58   1e-08
SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   2e-08
SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9)                  54   1e-07
SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8)                 54   1e-07
SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7)                    54   1e-07
SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8)                   54   1e-07
SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3)                     54   1e-07
SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07)                 54   1e-07
SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6)            54   1e-07
SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07)        54   1e-07
SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5)             54   1e-07
SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014)          54   1e-07
SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3)                  54   1e-07
SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_40003| Best HMM Match : YTV (HMM E-Value=8.9)                       54   1e-07
SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68)                54   1e-07
SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4)                    54   1e-07
SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15)             54   1e-07
SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5)                    54   1e-07
SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8)             54   1e-07
SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06)                   54   1e-07
SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46)            54   1e-07
SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08)               54   1e-07
SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10)              54   1e-07
SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14)               54   1e-07
SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014)                   54   1e-07
SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2)               54   1e-07
SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38)             54   1e-07
SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13)                54   1e-07
SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_7261| Best HMM Match : RHS (HMM E-Value=5.3)                        54   1e-07
SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_6047| Best HMM Match : CXC (HMM E-Value=7.7)                        54   1e-07
SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2)                       54   1e-07
SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031)                   54   1e-07
SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12)                     54   1e-07
SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.)                54   1e-07
SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.)                 54   1e-07
SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81)           54   1e-07
SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4)                 54   1e-07
SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4)                     54   1e-07
SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_55954| Best HMM Match : TIL (HMM E-Value=0.74)                      54   1e-07
SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5)                    54   1e-07
SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77)                    54   1e-07
SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2)              54   1e-07
SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1)                      54   1e-07
SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76)                 54   1e-07
SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1)                       54   1e-07
SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7)                     54   1e-07
SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7)                54   1e-07
SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8)                54   1e-07
SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69)                    54   1e-07
SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9)             54   1e-07
SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9)             54   1e-07
SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068)                54   1e-07
SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0)                54   1e-07
SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4)             54   1e-07
SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9)                    54   1e-07
SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5)                  54   1e-07
SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2)                    54   1e-07
SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4)                    54   1e-07
SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06)                  54   1e-07
SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3)               54   1e-07
SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4)                    54   1e-07
SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44)           54   1e-07
SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_21520| Best HMM Match : Trypsin (HMM E-Value=0)                     54   1e-07
SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_20904| Best HMM Match : Filament_head (HMM E-Value=10)              54   1e-07
SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3)              54   1e-07
SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21)               54   1e-07
SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2)                  54   1e-07
SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_8817| Best HMM Match : I-set (HMM E-Value=0)                        54   1e-07
SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9)                      54   1e-07
SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3)                   54   1e-07
SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4)                 54   1e-07
SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53)                       54   1e-07
SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2)              54   1e-07
SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.)                54   1e-07
SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.)                54   1e-07
SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.)                54   1e-07
SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35)                   54   2e-07
SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   2e-07
SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   2e-07
SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   2e-07
SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016)                   53   4e-07
SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0)               53   4e-07
SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17)         53   4e-07
SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2)                52   5e-07
SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37)                   52   5e-07
SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8)                    52   5e-07
SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   5e-07
SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)                     52   9e-07
SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   1e-06
SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   1e-06
SB_17253| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   2e-06
SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   2e-06
SB_51749| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   3e-06
SB_51748| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   3e-06
SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   4e-06
SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   5e-06
SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17)               48   1e-05
SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   2e-05
SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.)               47   2e-05
SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.)               47   2e-05
SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   2e-05
SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   2e-05
SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   2e-05
SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.)                47   2e-05
SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12)                     46   5e-05
SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)               46   5e-05
SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014)                  46   5e-05
SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1)                    46   5e-05
SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027)           46   5e-05
SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     46   5e-05
SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16)             46   5e-05
SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10)          46   5e-05
SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092)                   46   5e-05
SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_54473| Best HMM Match : DLIC (HMM E-Value=0)                        46   5e-05
SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1)           46   5e-05
SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3)                   46   5e-05
SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6)                    46   5e-05
SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9)                    46   5e-05
SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6)                    46   5e-05
SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05
SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   5e-05

>SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 602

 Score = 69.3 bits (162), Expect = 4e-12
 Identities = 31/36 (86%), Positives = 32/36 (88%), Gaps = 1/36 (2%)
 Frame = -2

Query: 955 VLQGD*-VG*RQGFPGHDVVKRRPVNCNTTHYRANW 851
           VLQGD  +G RQGFP HDVVKRRPVNCNTTHYRANW
Sbjct: 67  VLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102


>SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 68.1 bits (159), Expect = 1e-11
 Identities = 30/34 (88%), Positives = 32/34 (94%)
 Frame = +2

Query: 854 IRPIVSRITIHWPSFYNVVTWKTLALPNLIALQH 955
           +RP+VSRITIHW SFYNVVT KTLALPNLIALQH
Sbjct: 33  LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQH 66


>SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score = 65.7 bits (153), Expect = 5e-11
 Identities = 29/32 (90%), Positives = 30/32 (93%)
 Frame = +2

Query: 860 PIVSRITIHWPSFYNVVTWKTLALPNLIALQH 955
           P +SRITIHWPSFYNVVT KTLALPNLIALQH
Sbjct: 77  PYMSRITIHWPSFYNVVTGKTLALPNLIALQH 108


>SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 62.9 bits (146), Expect = 4e-10
 Identities = 28/29 (96%), Positives = 28/29 (96%)
 Frame = +2

Query: 869 SRITIHWPSFYNVVTWKTLALPNLIALQH 955
           SRITIHWPSFYNVVT KTLALPNLIALQH
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLIALQH 30


>SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 62.9 bits (146), Expect = 4e-10
 Identities = 28/29 (96%), Positives = 28/29 (96%)
 Frame = +2

Query: 869 SRITIHWPSFYNVVTWKTLALPNLIALQH 955
           SRITIHWPSFYNVVT KTLALPNLIALQH
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLIALQH 30


>SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2)
          Length = 98

 Score = 62.9 bits (146), Expect = 4e-10
 Identities = 28/29 (96%), Positives = 28/29 (96%)
 Frame = +2

Query: 869 SRITIHWPSFYNVVTWKTLALPNLIALQH 955
           SRITIHWPSFYNVVT KTLALPNLIALQH
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLIALQH 30


>SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 287

 Score = 62.1 bits (144), Expect = 6e-10
 Identities = 24/26 (92%), Positives = 24/26 (92%)
 Frame = -2

Query: 928 RQGFPGHDVVKRRPVNCNTTHYRANW 851
           R GFP HDVVKRRPVNCNTTHYRANW
Sbjct: 55  RSGFPSHDVVKRRPVNCNTTHYRANW 80


>SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 61.3 bits (142), Expect = 1e-09
 Identities = 24/29 (82%), Positives = 26/29 (89%)
 Frame = -2

Query: 937 VG*RQGFPGHDVVKRRPVNCNTTHYRANW 851
           +G  +GFP HDVVKRRPVNCNTTHYRANW
Sbjct: 31  LGNAKGFPSHDVVKRRPVNCNTTHYRANW 59



 Score = 28.7 bits (61), Expect = 7.4
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -3

Query: 954 CCKAIKLGNARVF 916
           CCKAIKLGNA+ F
Sbjct: 25  CCKAIKLGNAKGF 37


>SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 408

 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 23/24 (95%), Positives = 23/24 (95%)
 Frame = -2

Query: 922 GFPGHDVVKRRPVNCNTTHYRANW 851
           GFP HDVVKRRPVNCNTTHYRANW
Sbjct: 1   GFPSHDVVKRRPVNCNTTHYRANW 24


>SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)
          Length = 2506

 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 23/24 (95%), Positives = 23/24 (95%)
 Frame = -2

Query: 922 GFPGHDVVKRRPVNCNTTHYRANW 851
           GFP HDVVKRRPVNCNTTHYRANW
Sbjct: 625 GFPSHDVVKRRPVNCNTTHYRANW 648


>SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 23/24 (95%), Positives = 23/24 (95%)
 Frame = -2

Query: 922 GFPGHDVVKRRPVNCNTTHYRANW 851
           GFP HDVVKRRPVNCNTTHYRANW
Sbjct: 57  GFPSHDVVKRRPVNCNTTHYRANW 80



 Score = 33.9 bits (74), Expect = 0.20
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGF 918
           CAARRLSWVTPGF
Sbjct: 46  CAARRLSWVTPGF 58


>SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)
          Length = 281

 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 23/24 (95%), Positives = 23/24 (95%)
 Frame = -2

Query: 922 GFPGHDVVKRRPVNCNTTHYRANW 851
           GFP HDVVKRRPVNCNTTHYRANW
Sbjct: 68  GFPSHDVVKRRPVNCNTTHYRANW 91


>SB_4159| Best HMM Match : Vpu (HMM E-Value=2)
          Length = 779

 Score = 60.1 bits (139), Expect = 3e-09
 Identities = 23/24 (95%), Positives = 23/24 (95%)
 Frame = -2

Query: 922 GFPGHDVVKRRPVNCNTTHYRANW 851
           GFP HDVVKRRPVNCNTTHYRANW
Sbjct: 68  GFPSHDVVKRRPVNCNTTHYRANW 91


>SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 98

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 27/28 (96%), Positives = 27/28 (96%)
 Frame = +2

Query: 869 SRITIHWPSFYNVVTWKTLALPNLIALQ 952
           SRITIHWPSFYNVVT KTLALPNLIALQ
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLIALQ 29


>SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 32  CAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29)
          Length = 269

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 244 CAARRLSWVTPGFSQSRRCKTTASEL 269


>SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 937

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 912 CAARRLSWVTPGFSQSRRCKTTASEL 937


>SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTASEL 50


>SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 49

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 24  CAARRLSWVTPGFSQSRRCKTTASEL 49


>SB_47291| Best HMM Match : PilN (HMM E-Value=0.75)
          Length = 424

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 399 CAARRLSWVTPGFSQSRRCKTTASEL 424


>SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53)
          Length = 273

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 248 CAARRLSWVTPGFSQSRRCKTTASEL 273


>SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14)
          Length = 340

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 315 CAARRLSWVTPGFSQSRRCKTTASEL 340


>SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)
          Length = 406

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 381 CAARRLSWVTPGFSQSRRCKTTASEL 406


>SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6)
          Length = 98

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 73  CAARRLSWVTPGFSQSRRCKTTASEL 98


>SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 372

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 32  CAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTASEL 50


>SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTASEL 50


>SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 32  CAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 32  CAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 80

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 55  CAARRLSWVTPGFSQSRRCKTTASEL 80


>SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11)
          Length = 316

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 291 CAARRLSWVTPGFSQSRRCKTTASEL 316


>SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8)
          Length = 300

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 275 CAARRLSWVTPGFSQSRRCKTTASEL 300


>SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 50

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTASEL 50


>SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30)
          Length = 289

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 264 CAARRLSWVTPGFSQSRRCKTTASEL 289


>SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7)
          Length = 314

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 289 CAARRLSWVTPGFSQSRRCKTTASEL 314


>SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 498

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 473 CAARRLSWVTPGFSQSRRCKTTASEL 498


>SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22)
          Length = 455

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 142 CAARRLSWVTPGFSQSRRCKTTASEL 167


>SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37)
          Length = 333

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 308 CAARRLSWVTPGFSQSRRCKTTASEL 333


>SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 183

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 158 CAARRLSWVTPGFSQSRRCKTTASEL 183


>SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 32  CAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 376

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 351 CAARRLSWVTPGFSQSRRCKTTASEL 376


>SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 32  CAARRLSWVTPGFSQSRRCKTTASEL 57


>SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 43

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 18  CAARRLSWVTPGFSQSRRCKTTASEL 43


>SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 242

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 217 CAARRLSWVTPGFSQSRRCKTTASEL 242


>SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18)
          Length = 634

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 609 CAARRLSWVTPGFSQSRRCKTTASEL 634


>SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2021

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 245 CAARRLSWVTPGFSQSRRCKTTASEL 270


>SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 85  CAARRLSWVTPGFSQSRRCKTTASEL 110


>SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 548

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 523 CAARRLSWVTPGFSQSRRCKTTASEL 548


>SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 106 CAARRLSWVTPGFSQSRRCKTTASEL 131


>SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 439

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 414 CAARRLSWVTPGFSQSRRCKTTASEL 439


>SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 43

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 18  CAARRLSWVTPGFSQSRRCKTTASEL 43


>SB_9250| Best HMM Match : BAG (HMM E-Value=6.2)
          Length = 232

 Score = 58.0 bits (134), Expect = 1e-08
 Identities = 25/26 (96%), Positives = 26/26 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTPGFS+SRRCKTTASEL
Sbjct: 207 CAARRLSWVTPGFSQSRRCKTTASEL 232


>SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 97

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 26/27 (96%), Positives = 26/27 (96%)
 Frame = +2

Query: 869 SRITIHWPSFYNVVTWKTLALPNLIAL 949
           SRITIHWPSFYNVVT KTLALPNLIAL
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLIAL 28


>SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4)
          Length = 117

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = -2

Query: 919 FPGHDVVKRRPVNCNTTHYRANW 851
           FP HDVVKRRPVNCNTTHYRANW
Sbjct: 39  FPSHDVVKRRPVNCNTTHYRANW 61


>SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1907

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = -2

Query: 919  FPGHDVVKRRPVNCNTTHYRANW 851
            FP HDVVKRRPVNCNTTHYRANW
Sbjct: 1877 FPSHDVVKRRPVNCNTTHYRANW 1899


>SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 206

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = -2

Query: 919 FPGHDVVKRRPVNCNTTHYRANW 851
           FP HDVVKRRPVNCNTTHYRANW
Sbjct: 37  FPSHDVVKRRPVNCNTTHYRANW 59


>SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)
          Length = 768

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = -2

Query: 919 FPGHDVVKRRPVNCNTTHYRANW 851
           FP HDVVKRRPVNCNTTHYRANW
Sbjct: 31  FPSHDVVKRRPVNCNTTHYRANW 53



 Score = 30.3 bits (65), Expect = 2.4
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -3

Query: 954 CCKAIKLGNARVF 916
           CCKAIKLGNA VF
Sbjct: 19  CCKAIKLGNASVF 31


>SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 197

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = -2

Query: 919 FPGHDVVKRRPVNCNTTHYRANW 851
           FP HDVVKRRPVNCNTTHYRANW
Sbjct: 45  FPSHDVVKRRPVNCNTTHYRANW 67



 Score = 30.3 bits (65), Expect = 2.4
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -3

Query: 954 CCKAIKLGNARVF 916
           CCKAIKLGNA VF
Sbjct: 33  CCKAIKLGNASVF 45


>SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 25/29 (86%), Positives = 26/29 (89%)
 Frame = +2

Query: 869 SRITIHWPSFYNVVTWKTLALPNLIALQH 955
           SRITIHWPSFYNVVT KTLALPNL  L+H
Sbjct: 2   SRITIHWPSFYNVVTGKTLALPNLFDLRH 30


>SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 166

 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 24/25 (96%), Positives = 25/25 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASE 882
           CAARRLSWVTPGFS+SRRCKTTASE
Sbjct: 32  CAARRLSWVTPGFSQSRRCKTTASE 56



 Score = 46.0 bits (104), Expect = 5e-05
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = +1

Query: 886 LAVVLQRRDLENPGVTQLNRLAA 954
           LAVVLQRRD ENPGVTQLNRLAA
Sbjct: 85  LAVVLQRRDWENPGVTQLNRLAA 107


>SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 925

 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 24/25 (96%), Positives = 25/25 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASE 882
           CAARRLSWVTPGFS+SRRCKTTASE
Sbjct: 554 CAARRLSWVTPGFSQSRRCKTTASE 578


>SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3213

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 500 CAARRLSWVTPGFSQSRRCKTTAS 523


>SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 55

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9)
          Length = 123

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8)
          Length = 212

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 170 CAARRLSWVTPGFSQSRRCKTTAS 193


>SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 55

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 64

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 72

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 328

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 247 CAARRLSWVTPGFSQSRRCKTTAS 270


>SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 431

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 391 CAARRLSWVTPGFSQSRRCKTTAS 414


>SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7)
          Length = 141

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 69

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 77

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8)
          Length = 533

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 93  CAARRLSWVTPGFSQSRRCKTTAS 116


>SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 67

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3)
          Length = 185

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07)
          Length = 1127

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 674 CAARRLSWVTPGFSQSRRCKTTAS 697


>SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 473

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 829

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 180 CAARRLSWVTPGFSQSRRCKTTAS 203


>SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 111

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 68

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6)
          Length = 388

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07)
          Length = 305

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 68

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5)
          Length = 154

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 49

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 24/26 (92%), Positives = 25/26 (96%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTASEL 879
           CAARRLSWVTP FS+SRRCKTTASEL
Sbjct: 24  CAARRLSWVTPVFSQSRRCKTTASEL 49


>SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 115

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014)
          Length = 735

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 583 CAARRLSWVTPGFSQSRRCKTTAS 606


>SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3)
          Length = 666

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 430 CAARRLSWVTPGFSQSRRCKTTAS 453


>SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 151

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_40003| Best HMM Match : YTV (HMM E-Value=8.9)
          Length = 128

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68)
          Length = 794

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 66

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 104

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 114

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 80

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 101

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 57  CAARRLSWVTPGFSQSRRCKTTAS 80


>SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1081

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 813 CAARRLSWVTPGFSQSRRCKTTAS 836


>SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4)
          Length = 240

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15)
          Length = 631

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 474 CAARRLSWVTPGFSQSRRCKTTAS 497


>SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 77

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5)
          Length = 297

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8)
          Length = 143

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 93  CAARRLSWVTPGFSQSRRCKTTAS 116


>SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 91

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 39  CAARRLSWVTPGFSQSRRCKTTAS 62


>SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 68

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 80

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06)
          Length = 214

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 534

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 395 CAARRLSWVTPGFSQSRRCKTTAS 418


>SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 113

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46)
          Length = 1232

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956  CAARRLSWVTPGFSRSRRCKTTAS 885
            CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 1129 CAARRLSWVTPGFSQSRRCKTTAS 1152


>SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08)
          Length = 412

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 320 CAARRLSWVTPGFSQSRRCKTTAS 343


>SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1758

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 134 CAARRLSWVTPGFSQSRRCKTTAS 157


>SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 87

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 44  CAARRLSWVTPGFSQSRRCKTTAS 67


>SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 70

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 6   CAARRLSWVTPGFSQSRRCKTTAS 29


>SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 67

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 18  CAARRLSWVTPGFSQSRRCKTTAS 41


>SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10)
          Length = 466

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 83

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 79

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14)
          Length = 322

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 117

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014)
          Length = 230

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 60  CAARRLSWVTPGFSQSRRCKTTAS 83


>SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 78

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 80

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 189

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 78

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 39  CAARRLSWVTPGFSQSRRCKTTAS 62


>SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2)
          Length = 218

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 66

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38)
          Length = 742

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 510 CAARRLSWVTPGFSQSRRCKTTAS 533


>SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13)
          Length = 184

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 83

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 66

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 64

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 81

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 118 CAARRLSWVTPGFSQSRRCKTTAS 141


>SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 78  CAARRLSWVTPGFSQSRRCKTTAS 101


>SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 84

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 67

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 70

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 76

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 80  CAARRLSWVTPGFSQSRRCKTTAS 103


>SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_7261| Best HMM Match : RHS (HMM E-Value=5.3)
          Length = 137

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 67

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 114

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 74  CAARRLSWVTPGFSQSRRCKTTAS 97


>SB_6047| Best HMM Match : CXC (HMM E-Value=7.7)
          Length = 90

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 73

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 374

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 69

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2)
          Length = 542

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 179 CAARRLSWVTPGFSQSRRCKTTAS 202


>SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031)
          Length = 546

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 159

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12)
          Length = 338

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 155

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81)
          Length = 427

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 77

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 72

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4)
          Length = 200

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 87

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 39  CAARRLSWVTPGFSQSRRCKTTAS 62


>SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 70

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 71

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 75

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4)
          Length = 220

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_55954| Best HMM Match : TIL (HMM E-Value=0.74)
          Length = 172

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 165

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 67

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5)
          Length = 248

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77)
          Length = 316

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 79

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 74

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 69

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2)
          Length = 253

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 216 CAARRLSWVTPGFSQSRRCKTTAS 239


>SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 196

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 152 CAARRLSWVTPGFSQSRRCKTTAS 175


>SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1)
          Length = 195

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 70

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 191

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 81

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76)
          Length = 250

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1)
          Length = 283

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 123 CAARRLSWVTPGFSQSRRCKTTAS 146


>SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 109

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 55

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 64

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 167

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 849

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 79  CAARRLSWVTPGFSQSRRCKTTAS 102


>SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 82

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7)
          Length = 144

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 224

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 85

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7)
          Length = 128

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 117

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 60

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 18  CAARRLSWVTPGFSQSRRCKTTAS 41


>SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8)
          Length = 271

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 82

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 83

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 39  CAARRLSWVTPGFSQSRRCKTTAS 62


>SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 78

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69)
          Length = 199

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 60

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 18  CAARRLSWVTPGFSQSRRCKTTAS 41


>SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9)
          Length = 152

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 180

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 101

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 135

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9)
          Length = 206

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068)
          Length = 229

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 97

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0)
          Length = 1814

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 717 CAARRLSWVTPGFSQSRRCKTTAS 740


>SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 124

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


>SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 25  CAARRLSWVTPGFSQSRRCKTTAS 48


>SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4)
          Length = 164

 Score = 54.4 bits (125), Expect = 1e-07
 Identities = 23/24 (95%), Positives = 24/24 (100%)
 Frame = -1

Query: 956 CAARRLSWVTPGFSRSRRCKTTAS 885
           CAARRLSWVTPGFS+SRRCKTTAS
Sbjct: 47  CAARRLSWVTPGFSQSRRCKTTAS 70


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,107,022
Number of Sequences: 59808
Number of extensions: 651282
Number of successful extensions: 5141
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 4805
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5137
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2812459436
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).