SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0024
         (892 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_33021| Best HMM Match : No HMM Matches (HMM E-Value=.)             192   3e-49
SB_57838| Best HMM Match : No HMM Matches (HMM E-Value=.)             112   4e-25
SB_46051| Best HMM Match : ubiquitin (HMM E-Value=0)                  112   4e-25
SB_25984| Best HMM Match : ubiquitin (HMM E-Value=0)                  112   4e-25
SB_28758| Best HMM Match : ubiquitin (HMM E-Value=1.5e-29)             99   6e-21
SB_20850| Best HMM Match : ubiquitin (HMM E-Value=0.00037)             74   1e-13
SB_41074| Best HMM Match : ubiquitin (HMM E-Value=2.3e-10)             44   2e-04
SB_59029| Best HMM Match : Pkinase (HMM E-Value=0)                     35   0.077
SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05)             35   0.10 
SB_25220| Best HMM Match : Ank (HMM E-Value=6.2e-11)                   34   0.13 
SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18)                32   0.54 
SB_42868| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.95 
SB_1967| Best HMM Match : ubiquitin (HMM E-Value=4.7e-12)              31   1.3  
SB_56543| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.9  
SB_35539| Best HMM Match : RVT_1 (HMM E-Value=1.7e-07)                 28   8.8  
SB_59803| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.8  
SB_54480| Best HMM Match : Folate_rec (HMM E-Value=1.5)                28   8.8  

>SB_33021| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 157

 Score =  192 bits (468), Expect = 3e-49
 Identities = 97/134 (72%), Positives = 101/134 (75%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV      
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 KNY+TP          KLAVL++YKVDENGKI RLRREC  E CGAGVFMA   
Sbjct: 77  AKKRKKKNYTTPKKIKHKKKKVKLAVLKYYKVDENGKITRLRRECPSESCGAGVFMASHF 136

Query: 531 DRHYCGKCHSTMVF 490
           DR YCGKC  T VF
Sbjct: 137 DRQYCGKCCLTYVF 150


>SB_57838| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 533

 Score =  112 bits (269), Expect = 4e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 4e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 4e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 4e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298



 Score =  112 bits (269), Expect = 4e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 321 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374



 Score =  112 bits (269), Expect = 4e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 397 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450



 Score =  112 bits (269), Expect = 4e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 473 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526


>SB_46051| Best HMM Match : ubiquitin (HMM E-Value=0)
          Length = 381

 Score =  112 bits (269), Expect = 4e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 4e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 4e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 4e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298



 Score =  112 bits (269), Expect = 4e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 321 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374


>SB_25984| Best HMM Match : ubiquitin (HMM E-Value=0)
          Length = 147

 Score =  112 bits (269), Expect = 4e-25
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 31/53 (58%), Positives = 43/53 (81%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           VE SDT+E+VK KIQ++EGIPP  QRL++  ++L D R+L+DYNI++ S LHL
Sbjct: 92  VEASDTVESVKEKIQNREGIPPKVQRLLYEEEELVDNRSLADYNIKQGSILHL 144


>SB_28758| Best HMM Match : ubiquitin (HMM E-Value=1.5e-29)
          Length = 142

 Score = 98.7 bits (235), Expect = 6e-21
 Identities = 46/47 (97%), Positives = 47/47 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQK 751
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQK
Sbjct: 95  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 141


>SB_20850| Best HMM Match : ubiquitin (HMM E-Value=0.00037)
          Length = 150

 Score = 74.1 bits (174), Expect = 1e-13
 Identities = 34/35 (97%), Positives = 35/35 (100%)
 Frame = -2

Query: 834 IPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           IPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 2   IPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 36


>SB_41074| Best HMM Match : ubiquitin (HMM E-Value=2.3e-10)
          Length = 333

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/52 (44%), Positives = 29/52 (55%)
 Frame = -2

Query: 885 PSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           P  TI  VK  I+ K G P +QQRL+F G+ L D  T     I   +TLHL+
Sbjct: 90  PKHTIIEVKYLIEAKGGYPKDQQRLVFNGQVLSDEDTFEKVGIFAGATLHLI 141


>SB_59029| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 1023

 Score = 35.1 bits (77), Expect = 0.077
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 3/48 (6%)
 Frame = -2

Query: 879 DTIENVKAKIQ---DKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKES 745
           +T+  +K KI+    K+  P    +LI+AGK L D   L +YNI ++S
Sbjct: 87  ETVLKLKQKIEADKGKDAYPHGNIKLIYAGKILNDDNPLKEYNIDEKS 134


>SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05)
          Length = 198

 Score = 34.7 bits (76), Expect = 0.10
 Identities = 14/28 (50%), Positives = 21/28 (75%)
 Frame = -2

Query: 843 KEGIPPNQQRLIFAGKQLEDGRTLSDYN 760
           +EGIP  +QRLIF GK L+D + L +++
Sbjct: 19  EEGIPAERQRLIFKGKVLQDEKKLKEFD 46


>SB_25220| Best HMM Match : Ank (HMM E-Value=6.2e-11)
          Length = 744

 Score = 34.3 bits (75), Expect = 0.13
 Identities = 16/38 (42%), Positives = 26/38 (68%)
 Frame = -2

Query: 864 VKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQK 751
           +K++I+ K GIP + QRL F  K+L D  TL+  N+++
Sbjct: 32  LKSRIELKTGIPGDIQRLHFMNKELYDDATLAKVNLKQ 69


>SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18)
          Length = 796

 Score = 32.3 bits (70), Expect = 0.54
 Identities = 13/26 (50%), Positives = 19/26 (73%)
 Frame = -2

Query: 837 GIPPNQQRLIFAGKQLEDGRTLSDYN 760
           GIP  +QRLIF GK L+D + L +++
Sbjct: 1   GIPAERQRLIFKGKVLQDEKKLKEFD 26


>SB_42868| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1353

 Score = 31.5 bits (68), Expect = 0.95
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFA-GKQLEDGRTLSDYNIQKESTLHL 733
           T+ ++K  + +K G+  +  RL+   GK++ D   L DYNI    T+ L
Sbjct: 86  TVGDLKTMVTNKTGLHVSVFRLVIPEGKEMFDCNLLKDYNISTGDTIRL 134


>SB_1967| Best HMM Match : ubiquitin (HMM E-Value=4.7e-12)
          Length = 348

 Score = 31.1 bits (67), Expect = 1.3
 Identities = 14/49 (28%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLED-GRTLSDYNIQKESTLHLV 730
           +EN +A ++ + G+P ++  L   G QL D  +TL+ Y++++   + +V
Sbjct: 23  VENFRALLEFESGVPASEISLYHDGVQLSDLKKTLTAYSVKENDVILMV 71


>SB_56543| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1076

 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/42 (30%), Positives = 22/42 (52%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQK 751
           TIE ++ ++ DK G PP  QR I   K  +   +L    +++
Sbjct: 57  TIEKLQNEVADKYGFPPKVQRWIIGKKMAKPNESLLQCKVRE 98


>SB_35539| Best HMM Match : RVT_1 (HMM E-Value=1.7e-07)
          Length = 1105

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 14/42 (33%), Positives = 19/42 (45%)
 Frame = -1

Query: 844 QRGNPSQSTKVDLCWKAAGRWTYPLGLQYPEGIHPPPGVEAS 719
           QRG  S+ T +   W+ +G +   L       IHPP  V  S
Sbjct: 299 QRGVSSRKTMISKAWQVSGVYHITLDANVTPVIHPPRRVAIS 340


>SB_59803| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 243

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 14/43 (32%), Positives = 25/43 (58%)
 Frame = -3

Query: 884 RQIPSRM*KLKFKTKRESLPINKG*SLLESSWKMDVPSRTTIS 756
           +QIP  M  L ++ + E+ P+N   +LL+ SW + + +  T S
Sbjct: 123 KQIPP-MKDLVYEPREENFPLNSNPALLKVSWTVGIDNWVTAS 164


>SB_54480| Best HMM Match : Folate_rec (HMM E-Value=1.5)
          Length = 635

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 9/17 (52%), Positives = 13/17 (76%)
 Frame = -2

Query: 612 ENGKIHRLRRECTGEQC 562
           + G+IH L++EC G QC
Sbjct: 106 DGGEIHNLQQECIGSQC 122


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,252,919
Number of Sequences: 59808
Number of extensions: 522849
Number of successful extensions: 1296
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1168
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1293
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2550281014
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).