SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0023
         (852 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15)               33   0.22 
SB_20935| Best HMM Match : F5_F8_type_C (HMM E-Value=6.1e-29)          29   4.8  
SB_56088| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  
SB_27593| Best HMM Match : AdoMet_Synthase (HMM E-Value=0.53)          28   8.4  
SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  
SB_20649| Best HMM Match : SpoIIP (HMM E-Value=1.3)                    28   8.4  

>SB_50468| Best HMM Match : Kazal_1 (HMM E-Value=1.3e-15)
          Length = 1724

 Score = 33.5 bits (73), Expect = 0.22
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 4/82 (4%)
 Frame = +3

Query: 195  DVLTAHLVLSGYPKPI----DIYNVNAPPTLRYKF*DLSMVRKNRLSTNCVKNYICRVPY 362
            D +T H+ +  Y  P     D Y  +A P + +    L++V K++  T    +++  +P 
Sbjct: 956  DAITEHVTMDVYAHPAFHPRDPYK-SAVPAVAFT---LALVNKHKTDTFRA-SFMLSLP- 1009

Query: 363  LFVRRRCYSWGVVHSRNIYPIE 428
            L  RR  Y+WGV  +RNI P +
Sbjct: 1010 LVTRRTRYAWGVTTARNIGPAD 1031


>SB_20935| Best HMM Match : F5_F8_type_C (HMM E-Value=6.1e-29)
          Length = 273

 Score = 29.1 bits (62), Expect = 4.8
 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 4/87 (4%)
 Frame = +3

Query: 342 YICRVPYLFVRRRCYSWGVVHSRNIYPIEIIGQLLSLV----PTSGKKNDVYPLYTMRRS 509
           Y C  PY   +R CY    V  R+I P   +           P +G+ N+V+  YT+ R 
Sbjct: 107 YFCPSPY---KRVCYQALGVQDRSIIPDARMTASSYYTDGYEPRNGRLNNVFVNYTVNRG 163

Query: 510 KHPIKHFLKN*SCLNIEEERLFGLNNI 590
               KH +     L ++  RL G+  +
Sbjct: 164 MWTAKHKVVG-EYLQVDVGRLVGVTKV 189


>SB_56088| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 172

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 2/55 (3%)
 Frame = +3

Query: 432 IGQLLSL--VPTSGKKNDVYPLYTMRRSKHPIKHFLKN*SCLNIEEERLFGLNNI 590
           + QLLS   VP+ G + DV+  Y        + HF+   SC+ ++ E    L ++
Sbjct: 56  VTQLLSALPVPSQGARQDVFLSYVRLTLLQKVNHFVIQHSCVFVQWESSIALLDV 110


>SB_27593| Best HMM Match : AdoMet_Synthase (HMM E-Value=0.53)
          Length = 794

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 19/79 (24%), Positives = 39/79 (49%)
 Frame = +3

Query: 432 IGQLLSLVPTSGKKNDVYPLYTMRRSKHPIKHFLKN*SCLNIEEERLFGLNNIFVILQES 611
           IG+LLSL   S  +N+VYPL  +       +  LK    L  + E   G + +   + +S
Sbjct: 64  IGELLSLHIGSNNQNNVYPLDLLLALAQSTRRSLKQSYLLLSDTELQRGYSELLSKITDS 123

Query: 612 HLKLNISKKYRNKIKLLRL 668
             K+++ +  ++ + + ++
Sbjct: 124 LGKVSLDELMKSLLAIAQI 142


>SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1360

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = -2

Query: 431  NLNWINISRMDHAPRITTTANKQIRNPTDIIFD 333
            N+N I+    ++  RIT  ANK++ N  D+ FD
Sbjct: 1231 NINKISRKNYNNGLRITIEANKRVVNFLDVTFD 1263


>SB_20649| Best HMM Match : SpoIIP (HMM E-Value=1.3)
          Length = 466

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = -2

Query: 431 NLNWINISRMDHAPRITTTANKQIRNPTDIIFD 333
           N+N I+    ++  RIT  ANK++ N  D+ FD
Sbjct: 337 NINKISRKNYNNGLRITIEANKRVVNFLDVTFD 369


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,675,214
Number of Sequences: 59808
Number of extensions: 543462
Number of successful extensions: 1212
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1135
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1212
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2419355818
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).