SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0021
         (602 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0)                37   0.011
SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35)                   30   1.3  
SB_38450| Best HMM Match : zf-CCHC (HMM E-Value=0.00018)               28   5.1  
SB_45545| Best HMM Match : Vicilin_N (HMM E-Value=1.1)                 28   6.7  
SB_26352| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.7  

>SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0)
          Length = 672

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = +2

Query: 158 EESSKFQQMQDEMSRFEAEISG-GTGRAVIGSGTWD-AVQARLERVAPMQAPPEPSPSIM 331
           E+S +  ++++EMSRFE EI+G    R +I + T+  A QA  E V     PP+ +   +
Sbjct: 8   EDSERKNELEEEMSRFEQEIAGHPVPRPIISANTFKMASQAIQEAVVHNVPPPQITARPV 67

Query: 332 AP 337
           AP
Sbjct: 68  AP 69


>SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35)
          Length = 2049

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 3/61 (4%)
 Frame = -3

Query: 276 RACTASHVPDPITARPVPPDISASNLDISSCIC*NFEDSSM--MKRQP-*P*RIPKDLRT 106
           R  T     +P+ A   P D +   L +S C+C  F+ SSM  + R+P  P + PKDL+ 
Sbjct: 79  RKRTTGDAINPL-AVTTPSDSTHQFLRVSGCVCRVFQLSSMPLLNRKPFTPEKPPKDLKP 137

Query: 105 N 103
           N
Sbjct: 138 N 138


>SB_38450| Best HMM Match : zf-CCHC (HMM E-Value=0.00018)
          Length = 1066

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 13/46 (28%), Positives = 24/46 (52%)
 Frame = -1

Query: 326 SKGWVLVGPALEPPVLDGLARHPMCQIRSLHVQCLLIFQLQTWTSH 189
           S G +++G  L    LD   +HP+   +  HV  L++ ++   +SH
Sbjct: 768 SPGLLIIGGRLRQASLDDTVKHPIILPKDGHVTWLIVKEVHGKSSH 813


>SB_45545| Best HMM Match : Vicilin_N (HMM E-Value=1.1)
          Length = 729

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 13/26 (50%), Positives = 16/26 (61%)
 Frame = -3

Query: 264 ASHVPDPITARPVPPDISASNLDISS 187
           +SH P P   RPV PD+S S  D+ S
Sbjct: 390 SSHKPGPPGDRPVHPDVSRSLGDVRS 415


>SB_26352| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 283

 Score = 27.9 bits (59), Expect = 6.7
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = +1

Query: 43  DARMCMYFNKRHIVVPKLSNISA*IFWNSLR 135
           D+RM M   +RH +VP L  +    FW   R
Sbjct: 6   DSRMAMRVKQRHGMVPPLDQLEYDDFWKEFR 36


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,789,641
Number of Sequences: 59808
Number of extensions: 336341
Number of successful extensions: 946
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 871
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 945
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1463691625
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).