SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0020
         (788 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_56628| Best HMM Match : Actin (HMM E-Value=0)                      492   e-139
SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)             486   e-138
SB_56| Best HMM Match : Actin (HMM E-Value=0)                         485   e-137
SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)              481   e-136
SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)              383   e-106
SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)             254   8e-68
SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)             232   2e-61
SB_54| Best HMM Match : Actin (HMM E-Value=0)                         225   3e-59
SB_3885| Best HMM Match : Actin (HMM E-Value=0.77)                    205   4e-53
SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)            172   2e-43
SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)                 106   2e-23
SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)                 82   6e-16
SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10)                 71   8e-13
SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)                  60   3e-09
SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)                  58   6e-09
SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)               56   2e-08
SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_28400| Best HMM Match : PMSR (HMM E-Value=1.7e-24)                  40   0.002
SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.065
SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.086
SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.11 
SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19)          34   0.11 
SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.20 
SB_55640| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.35 
SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.35 
SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024)                  33   0.35 
SB_34189| Best HMM Match : MAM (HMM E-Value=5.60519e-45)               32   0.61 
SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.80 
SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.80 
SB_13911| Best HMM Match : PAN (HMM E-Value=0.033)                     31   0.80 
SB_18097| Best HMM Match : NadA (HMM E-Value=2.2)                      31   0.80 
SB_8780| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   0.80 
SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)                    31   0.80 
SB_21074| Best HMM Match : NadA (HMM E-Value=2)                        31   1.1  
SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0)                       31   1.1  
SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.1  
SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.4  
SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8)                    31   1.4  
SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75)               31   1.4  
SB_43551| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.027)          31   1.4  
SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.4  
SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28)                    31   1.4  
SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28)                    30   1.9  
SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.9  
SB_10843| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.9  
SB_8336| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.84)            30   1.9  
SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)              30   1.9  
SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.)               30   1.9  
SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.9  
SB_27518| Best HMM Match : RWD (HMM E-Value=0.015)                     30   1.9  
SB_23053| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.9  
SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27)                 30   1.9  
SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)              30   1.9  
SB_52278| Best HMM Match : Ery_res_leader1 (HMM E-Value=0.94)          30   2.5  
SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4)            30   2.5  
SB_58934| Best HMM Match : TPR_1 (HMM E-Value=3.8e-37)                 30   2.5  
SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.5  
SB_36880| Best HMM Match : DUF1337 (HMM E-Value=0.54)                  29   3.2  
SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.3  
SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062)              29   4.3  
SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2)                   29   4.3  
SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39)                 29   4.3  
SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.7  
SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40)                 29   5.7  
SB_28336| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.7  
SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74)           29   5.7  
SB_19751| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.7  
SB_6983| Best HMM Match : rve (HMM E-Value=0.011)                      29   5.7  
SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   5.7  
SB_46336| Best HMM Match : DUF1518 (HMM E-Value=5.6)                   29   5.7  
SB_42612| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.7  
SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05)                   29   5.7  
SB_11585| Best HMM Match : TPR_MLP1_2 (HMM E-Value=2.2)                29   5.7  
SB_1754| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   5.7  
SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42)                28   7.5  
SB_34370| Best HMM Match : DUF1656 (HMM E-Value=0.59)                  28   7.5  
SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.5  
SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.5  
SB_10665| Best HMM Match : PT (HMM E-Value=6.2)                        28   7.5  
SB_8208| Best HMM Match : ShTK (HMM E-Value=1.2e-21)                   28   7.5  
SB_36012| Best HMM Match : DUF755 (HMM E-Value=0.064)                  28   7.5  
SB_7840| Best HMM Match : S-antigen (HMM E-Value=0.11)                 28   7.5  
SB_41475| Best HMM Match : HSA (HMM E-Value=7.5)                       28   9.9  
SB_30534| Best HMM Match : EGF (HMM E-Value=0.12)                      28   9.9  
SB_20112| Best HMM Match : EGF (HMM E-Value=0)                         28   9.9  
SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06)          28   9.9  
SB_3565| Best HMM Match : ASC (HMM E-Value=1.1e-12)                    28   9.9  
SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0)                     28   9.9  
SB_38165| Best HMM Match : Drf_FH1 (HMM E-Value=1)                     28   9.9  
SB_11044| Best HMM Match : FMO-like (HMM E-Value=3.4)                  28   9.9  

>SB_56628| Best HMM Match : Actin (HMM E-Value=0)
          Length = 376

 Score =  492 bits (1213), Expect = e-139
 Identities = 231/237 (97%), Positives = 236/237 (99%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLD
Sbjct: 121 TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMTTAASSSSL 237


>SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 376

 Score =  486 bits (1199), Expect = e-138
 Identities = 229/237 (96%), Positives = 235/237 (99%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           M D+E+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MEDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI+RLD
Sbjct: 121 TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAIIRLD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSL
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMETAASSSSL 237


>SB_56| Best HMM Match : Actin (HMM E-Value=0)
          Length = 375

 Score =  485 bits (1197), Expect = e-137
 Identities = 229/235 (97%), Positives = 234/235 (99%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           ++EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSL 236


>SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 375

 Score =  481 bits (1187), Expect = e-136
 Identities = 227/235 (96%), Positives = 234/235 (99%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAILRLDLA
Sbjct: 122 IMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKL YVALDFEQEMATAA+SSSL
Sbjct: 182 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAAASSSL 236


>SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 349

 Score =  383 bits (942), Expect = e-106
 Identities = 192/237 (81%), Positives = 201/237 (84%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           M D+++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DS            G  + H +    
Sbjct: 121 TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDS------------GDGVSHTV---- 164

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
                       I  ERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSSS+
Sbjct: 165 -----------PIYEERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSI 210


>SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 411

 Score =  254 bits (621), Expect = 8e-68
 Identities = 119/234 (50%), Positives = 162/234 (69%), Gaps = 3/234 (1%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRG 267
           + +V DNG+G  K G+AG + P  +FPS+VGRP  R    +  +  KD  VGDEA   R 
Sbjct: 7   SVIVCDNGTGFVKCGYAGSNFPAHIFPSMVGRPIIRSSQKVGDIEVKDLMVGDEASQLRY 66

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           +L + YP+++GIV NWDDM+ +W +TF  +++ + P    VLLTE PLNP  NREKM ++
Sbjct: 67  MLEVNYPMDNGIVRNWDDMKHVWDYTFGESKMNIDPRNTKVLLTEPPLNPMKNREKMIEV 126

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFE +    +Y+AIQAVL+LYA G  TG+V+DSGDGV+H  P+YEG+ALPH   RLD+AG
Sbjct: 127 MFENYQFEGVYIAIQAVLTLYAQGLLTGVVIDSGDGVTHICPVYEGFALPHLTRRLDIAG 186

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RD+T YL+K++  RGY+F  TA+ E VR +KEKLCYV  + EQE   A  ++ L
Sbjct: 187 RDITKYLIKLMLLRGYAFNHTADFETVRMMKEKLCYVGYNIEQEQKLALETTVL 240


>SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 338

 Score =  232 bits (568), Expect = 2e-61
 Identities = 112/122 (91%), Positives = 118/122 (96%)
 Frame = +1

Query: 421 NREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHA 600
           N + M +IMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHA
Sbjct: 78  NWDDMEKIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHA 137

Query: 601 ILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSS 780
           I+RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM TAASSS
Sbjct: 138 IIRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSS 197

Query: 781 SL 786
           SL
Sbjct: 198 SL 199



 Score =  183 bits (445), Expect = 2e-46
 Identities = 83/89 (93%), Positives = 86/89 (96%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D++VAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTF 348
           RGILTLKYPIEHGIVTNWDDMEKI   TF
Sbjct: 62  RGILTLKYPIEHGIVTNWDDMEKIMFETF 90


>SB_54| Best HMM Match : Actin (HMM E-Value=0)
          Length = 2486

 Score =  225 bits (550), Expect = 3e-59
 Identities = 100/150 (66%), Positives = 126/150 (84%)
 Frame = +1

Query: 328  KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 507
            K+W H F ++LRV  E+ PVLLTEAPLNPK NRE+M Q+MFE+FN P MYVA+QAV++LY
Sbjct: 2130 KMWEHAF-DQLRVRGEDFPVLLTEAPLNPKMNRERMVQLMFESFNVPCMYVAVQAVMALY 2188

Query: 508  ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT 687
            ASGRTTG V D GDGVSHTVP+Y+GY LPHA  R+DLAGRDLT YL +++TERGYSF +T
Sbjct: 2189 ASGRTTGTVFDCGDGVSHTVPVYDGYWLPHATQRIDLAGRDLTHYLQRLVTERGYSFQST 2248

Query: 688  AEREIVRDIKEKLCYVALDFEQEMATAASS 777
            AE++I+RD+KE LCY A+D+E+E+  A +S
Sbjct: 2249 AEQQIIRDLKETLCYCAMDYERELKEAETS 2278



 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 23/34 (67%), Positives = 30/34 (88%)
 Frame = +1

Query: 100  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 201
            +V+DNGSG CKAG + D++PR VFP+IVGRPRH+
Sbjct: 2097 VVIDNGSGFCKAGLSTDESPRVVFPAIVGRPRHK 2130


>SB_3885| Best HMM Match : Actin (HMM E-Value=0.77)
          Length = 152

 Score =  205 bits (500), Expect = 4e-53
 Identities = 96/106 (90%), Positives = 102/106 (96%)
 Frame = +1

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFE FN+PA+YVAIQAVLSLYASGRTTG+V DSGDGVSH VPIYEGYALPHAILRLDLA
Sbjct: 1   IMFEAFNSPAVYVAIQAVLSLYASGRTTGVVFDSGDGVSHNVPIYEGYALPHAILRLDLA 60

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           GRDLTDYLMK++TERGYSFTTTAEREIVRDIKEKLCYVALDF QE+
Sbjct: 61  GRDLTDYLMKLMTERGYSFTTTAEREIVRDIKEKLCYVALDFYQEI 106


>SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)
          Length = 367

 Score =  172 bits (419), Expect = 2e-43
 Identities = 74/116 (63%), Positives = 101/116 (87%)
 Frame = +1

Query: 376 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 555
           +HPVLLTEAPLNP+ NREK  ++ FETFN PA+++++QAVLSLYA+GRTTG+VLD+GDGV
Sbjct: 126 QHPVLLTEAPLNPRRNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDAGDGV 185

Query: 556 SHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEK 723
           SH+VPIYEG+A+PH+I+R D+AGRD++ YL  +L + G+ F +++E EIVR IKE+
Sbjct: 186 SHSVPIYEGFAMPHSIMRTDIAGRDVSRYLRLLLRKEGHCFHSSSELEIVRTIKEE 241


>SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)
          Length = 240

 Score =  106 bits (254), Expect = 2e-23
 Identities = 47/126 (37%), Positives = 80/126 (63%)
 Frame = +1

Query: 286 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 465
           PI+ G++ +WD  EKI  + +   ++     HP+L++EA  N +  REK+T++MFE +N 
Sbjct: 3   PIKDGMIEDWDLFEKILDYIYSKNIKSDSALHPLLMSEAAWNTRIKREKLTELMFEKYNV 62

Query: 466 PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYL 645
           PA ++   +VL+ +A+GR+ G+V+DSG   +  VP+++GY L  AI+R  LAG  +T   
Sbjct: 63  PAFFLCKNSVLTAFANGRSNGLVIDSGATQTSAVPVHDGYVLQQAIVRSPLAGDFITAQC 122

Query: 646 MKILTE 663
            ++  E
Sbjct: 123 RQMFEE 128


>SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)
          Length = 921

 Score = 81.8 bits (193), Expect = 6e-16
 Identities = 41/101 (40%), Positives = 63/101 (62%), Gaps = 1/101 (0%)
 Frame = +1

Query: 487  QAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL-TE 663
            Q  LSLYASG T G+ L SG   +    IYEG+ L H +  L++ G  LT+ L + L  +
Sbjct: 767  QLSLSLYASGMTLGVCLSSGFSCTQAAVIYEGHTLNHTLQTLEIGGHHLTENLKQYLRDQ 826

Query: 664  RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
            RG++FT+++  +IV DIKEK+CY++ D  +E+    ++  L
Sbjct: 827  RGHNFTSSSGWQIVNDIKEKICYLSKDHLKEVHNYKTNEGL 867



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 29/73 (39%), Positives = 44/73 (60%), Gaps = 3/73 (4%)
 Frame = +1

Query: 70  FKMCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKD-SYV 240
           FK+      A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G  +  KD    
Sbjct: 693 FKLDSHYNRAIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIGDNVNVKDYKKY 752

Query: 241 GDEAQSKRGILTL 279
           GD A +K G++ L
Sbjct: 753 GDAAVAKSGVMHL 765


>SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10)
          Length = 543

 Score = 71.3 bits (167), Expect = 8e-13
 Identities = 36/104 (34%), Positives = 56/104 (53%), Gaps = 1/104 (0%)
 Frame = +1

Query: 454 TFNTPAMYVAIQAVLSLYASGRT-TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRD 630
           ++ T A+     +  S     RT TG V+DSGDGV+H +P+ EGY +   I  + +AGRD
Sbjct: 38  SYATKAVLALAASWTSRQVGERTLTGCVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRD 97

Query: 631 LTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           +T ++ ++L ER          E  + IKE+  Y+  D  +E A
Sbjct: 98  ITFFVQQLLREREMGIPPEQSMETAKTIKERWGYICPDIAKEFA 141


>SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)
          Length = 1392

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 27/39 (69%), Positives = 29/39 (74%)
 Frame = +1

Query: 85   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 201
            E    LV+D GS M K GFAGDDAP+ VFP IVGRPRHQ
Sbjct: 1354 EAPTPLVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQ 1392


>SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)
          Length = 580

 Score = 58.4 bits (135), Expect = 6e-09
 Identities = 47/182 (25%), Positives = 84/182 (46%), Gaps = 8/182 (4%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           ++A LV+D G+   K GFA + APR++ P+ + + + +       ++  ++GD+ +  + 
Sbjct: 232 KMATLVLDCGACSQKIGFASNQAPRSI-PNAIFKAKSE-------RRKLFIGDQIEECKD 283

Query: 268 ILTLKY--PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
              L Y  P + G + NWD  ++IW +TF  E                       + M +
Sbjct: 284 YSALFYVLPFQKGFLVNWDVEKQIWDYTFGKE--------------------GLEDAMDE 323

Query: 442 IMFETFNTPAMYVAIQAVLSLY------ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 603
           I+FE +N  A+     A LS Y       S     +V+D+G   +H VP++ G  +  A+
Sbjct: 324 ILFEEYNFKALSRTTAAQLSAYKCHQDMVSKNPVCLVVDTGYSFTHIVPVFNGKVIKKAV 383

Query: 604 LR 609
            R
Sbjct: 384 RR 385


>SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)
          Length = 372

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 26/60 (43%), Positives = 34/60 (56%)
 Frame = +1

Query: 214 GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 393
           G+   D ++GDEA  K    T K+PI H IV +WD ME+ W    +  LR  PE+H  LL
Sbjct: 278 GVEDLDFFIGDEAIDKPSYAT-KWPIRHAIVEDWDLMERFWEQCIFKYLRAEPEDHYFLL 336



 Score = 32.3 bits (70), Expect = 0.46
 Identities = 11/17 (64%), Positives = 15/17 (88%)
 Frame = +1

Query: 523 TGIVLDSGDGVSHTVPI 573
           TG V+DSGDGV+H +P+
Sbjct: 356 TGCVIDSGDGVTHVIPV 372


>SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 198

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 21/39 (53%), Positives = 27/39 (69%)
 Frame = -3

Query: 198 MAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRGNFFV 82
           MA  + D GE+G+ SI+S ETGLAHTGAI+  Q  +  V
Sbjct: 1   MARSADDGGENGSGSIVSGETGLAHTGAIIDNQSCDIIV 39


>SB_28400| Best HMM Match : PMSR (HMM E-Value=1.7e-24)
          Length = 766

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 20/68 (29%), Positives = 38/68 (55%)
 Frame = +1

Query: 331 IWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYA 510
           I  H F + L+V P +H V++T         +E++ +I+   F   A+Y+  Q++L++Y+
Sbjct: 513 ILEHAFLS-LKVDPVKHKVIMTIPQNTGLQEKEELVEILLGYFRVQAVYLQEQSILAMYS 571

Query: 511 SGRTTGIV 534
               +GIV
Sbjct: 572 YSAVSGIV 579


>SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2870

 Score = 35.1 bits (77), Expect = 0.065
 Identities = 17/46 (36%), Positives = 20/46 (43%)
 Frame = +2

Query: 467  PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
            PP   P  P  + TRP VP       +T  PTP P T     P P+
Sbjct: 919  PPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPA 964



 Score = 28.3 bits (60), Expect = 7.5
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 2/56 (3%)
 Frame = +2

Query: 446  CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCW--TPATVSPTPCPSTKDTHSPTPSC 607
            CS+HS +P C  PSK C +    V+PP +    T  ++ P  C ++     P   C
Sbjct: 1521 CSEHSCKPEC--PSKCCMK----VLPPTTLGQNTANSLCPVYCLTSCKPDCPIKCC 1570



 Score = 27.9 bits (59), Expect = 9.9
 Identities = 10/23 (43%), Positives = 11/23 (47%)
 Frame = +2

Query: 467  PPCTSPSKPCSRCTRPVVPPVSC 535
            PP   P  P    T P +PP SC
Sbjct: 973  PPLPPPPPPVQTTTAPTLPPASC 995


>SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 336

 Score = 34.7 bits (76), Expect = 0.086
 Identities = 29/77 (37%), Positives = 34/77 (44%)
 Frame = +3

Query: 477 RRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRPHRLPHEDP 656
           RR  S A   R RS  R R+  RRR        RR R+P  H  S  SRSR  R P    
Sbjct: 211 RRSHSPAHHRRSRSRSRSRSPRRRRRSRSPRRRRRSRSPSPHHRSHRSRSR-SRSPRRRH 269

Query: 657 HRARLLVHYHRRAGNRS 707
            R+R   H   R+ + S
Sbjct: 270 SRSRSPTHRRHRSRSHS 286


>SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1202

 Score = 34.3 bits (75), Expect = 0.11
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 2/48 (4%)
 Frame = +2

Query: 467 PPCTSP-SKPCSRCTRPVVPPVSCWTPATVSPTP-CPSTKDTHSPTPS 604
           P  TSP + P +R   P+ PP  C   + V PTP   S+K + SP+PS
Sbjct: 316 PAFTSPPNTPTTRTFSPISPPAGC-AASPVPPTPPAISSKRSFSPSPS 362


>SB_39781| Best HMM Match : cNMP_binding (HMM E-Value=2.2e-19)
          Length = 1211

 Score = 34.3 bits (75), Expect = 0.11
 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +2

Query: 455 HSTRP-PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPC 568
           H+T P P T PS P   C    + P  C+T  T+SP PC
Sbjct: 665 HTTHPSPATHPS-PSQPCPATHLSPKPCFTFVTLSPKPC 702



 Score = 29.9 bits (64), Expect = 2.5
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPC 568
           PC SPS P        + P  C+T  T+SP PC
Sbjct: 510 PCFSPSNPSPASH---LSPKPCFTSLTLSPKPC 539


>SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1011

 Score = 33.5 bits (73), Expect = 0.20
 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 2/52 (3%)
 Frame = +2

Query: 455 HSTRPPCTSPSKPCSRCTRPVVP--PVSCWTPATVSPTPCPSTKDTHSPTPS 604
           HST    ++PS P + CT P  P  P +  TP+T S    PST  T S TPS
Sbjct: 63  HSTPSAPSTPSTPSTPCT-PSTPSTPSTPSTPSTPSTPSAPSTPSTPS-TPS 112



 Score = 30.3 bits (65), Expect = 1.9
 Identities = 25/56 (44%), Positives = 31/56 (55%), Gaps = 5/56 (8%)
 Frame = +2

Query: 452 KHSTRPPCTSPSKPCSRCTRPVVP--PVSCWTPATVSPTPC-PSTKDTHSP--TPS 604
           K+  R   ++PS PC+  T P  P  P +  TP+T S TPC PST  T S   TPS
Sbjct: 2   KNPHRLKLSTPSTPCTPST-PSTPSTPSTPRTPSTPS-TPCTPSTPSTPSTPITPS 55



 Score = 28.7 bits (61), Expect = 5.7
 Identities = 22/45 (48%), Positives = 27/45 (60%), Gaps = 3/45 (6%)
 Frame = +2

Query: 476 TSPSKPCSRCTRPVVP--PVSCWTPATVSPTPC-PSTKDTHSPTP 601
           ++PS PC+  T P  P  P +  TP+T S TPC PST  T S TP
Sbjct: 375 STPSTPCTPST-PSTPSTPSTPRTPSTPS-TPCTPSTPSTPS-TP 416



 Score = 28.3 bits (60), Expect = 7.5
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 2/54 (3%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVP--PVSCWTPATVSPTPCPSTKDTHSPTPS 604
           S  ST     +PS P + CT P  P  P +  TP+T S TPC  +  +   TPS
Sbjct: 22  STPSTPSTPRTPSTPSTPCT-PSTPSTPSTPITPSTPS-TPCTHSTPSAPSTPS 73



 Score = 27.9 bits (59), Expect = 9.9
 Identities = 28/91 (30%), Positives = 34/91 (37%), Gaps = 4/91 (4%)
 Frame = +2

Query: 344 PSTMSCVSPPRNTQSCSXXXXXXXXXXXXXXXXXCSKHSTRPPCTSPSKPCSRCTRPVVP 523
           PST S  S P   ++ S                  +  +   PCT  S P +  T P  P
Sbjct: 18  PSTPSTPSTPSTPRTPSTPSTPCTPSTPSTPSTPITPSTPSTPCTH-STPSAPST-PSTP 75

Query: 524 PVSCW--TPATVSPTPCPSTKDTHS--PTPS 604
              C   TP+T S    PST  T S   TPS
Sbjct: 76  STPCTPSTPSTPSTPSTPSTPSTPSAPSTPS 106


>SB_55640| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1071

 Score = 32.7 bits (71), Expect = 0.35
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 9/51 (17%)
 Frame = +2

Query: 470 PCTSPSKPC----SRCTRPVVPPVSCWTPATVSPTPC-----PSTKDTHSP 595
           P T    PC    + CT+  +P    +TP T   TPC     PST+ +H+P
Sbjct: 844 PSTKRYTPCYERYTPCTKRYIPSAKRYTPCTERYTPCTKRYTPSTEPSHAP 894



 Score = 29.9 bits (64), Expect = 2.5
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 4/45 (8%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSR----CTRPVVPPVSCWTPATVSPTPC 568
           C++  T  PCT    PC+     CT    P    +TP+T   TPC
Sbjct: 626 CTERYT--PCTERYIPCTERYTPCTERYTPSTERYTPSTERYTPC 668



 Score = 29.1 bits (62), Expect = 4.3
 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 4/37 (10%)
 Frame = +2

Query: 470 PCTSPSKPC----SRCTRPVVPPVSCWTPATVSPTPC 568
           PCT    PC    + CT+   P    +TP T   TPC
Sbjct: 746 PCTERYTPCYERYTPCTKRYTPCTERYTPCTERYTPC 782


>SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 32.7 bits (71), Expect = 0.35
 Identities = 16/46 (34%), Positives = 21/46 (45%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           P   SP+ P      P  P  +  TP T +PT    TK T + TP+
Sbjct: 56  PTTPSPTAPTQTTPTPATPTPTTPTPKTPTPTTSTLTKPTPATTPT 101



 Score = 30.7 bits (66), Expect = 1.4
 Identities = 16/48 (33%), Positives = 22/48 (45%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           T P  T+P++     T P     +  TP   +PTP   T  T +PT S
Sbjct: 42  TTPTSTAPTQTTPTPTTPSPTAPTQTTPTPATPTPTTPTPKTPTPTTS 89



 Score = 29.9 bits (64), Expect = 2.5
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 1/47 (2%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPT-PCPSTKDTHSPTPS 604
           P   +P+KP         P  +  TP T SPT P  +T    +PTP+
Sbjct: 31  PTTHTPTKPSPTTPTSTAPTQTTPTPTTPSPTAPTQTTPTPATPTPT 77



 Score = 29.5 bits (63), Expect = 3.2
 Identities = 15/47 (31%), Positives = 19/47 (40%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPT 598
           +T  P T   K  +  T  +  P    TP    PTP   T  T +PT
Sbjct: 72  ATPTPTTPTPKTPTPTTSTLTKPTPATTPTPTKPTPTAHTPTTPTPT 118



 Score = 29.5 bits (63), Expect = 3.2
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 6/52 (11%)
 Frame = +2

Query: 461 TRP-PCTSPS--KPCSRCTRPVVPPVSCWTPATVSP-TPCPS--TKDTHSPT 598
           T+P P T+P+  KP      P  P  +  TP   +P TP P+  T   H+PT
Sbjct: 92  TKPTPATTPTPTKPTPTAHTPTTPTPTAHTPTKPTPKTPTPTTPTPTAHTPT 143



 Score = 29.1 bits (62), Expect = 4.3
 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 1/49 (2%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSP-TPS 604
           T+P  T+P+      T P     S   P   +PTP   T  T +P TP+
Sbjct: 37  TKPSPTTPTSTAPTQTTPTPTTPSPTAPTQTTPTPATPTPTTPTPKTPT 85



 Score = 28.7 bits (61), Expect = 5.7
 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 3/52 (5%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSP---TPCPSTKDTHSPTPS 604
           ST P  T+P+      T P     +  TP   +P   TP P+T     PTP+
Sbjct: 46  STAPTQTTPTPTTPSPTAPTQTTPTPATPTPTTPTPKTPTPTTSTLTKPTPA 97



 Score = 28.3 bits (60), Expect = 7.5
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPT 562
           P   +P+KP  +   P  P  +  TP T +PT
Sbjct: 117 PTAHTPTKPTPKTPTPTTPTPTAHTPTTPTPT 148


>SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024)
          Length = 286

 Score = 32.7 bits (71), Expect = 0.35
 Identities = 21/88 (23%), Positives = 30/88 (34%)
 Frame = +2

Query: 341 IPSTMSCVSPPRNTQSCSXXXXXXXXXXXXXXXXXCSKHSTRPPCTSPSKPCSRCTRPVV 520
           +PS M C  PP    S                    +   T    T+P+ P +  T P  
Sbjct: 86  LPSWMPCNCPPDEDDSKGGAAGAEEKEEGEGGGDTPTTAPTTA-ATTPTTPTTAPTTPTT 144

Query: 521 PPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           P  +  TP T + TP        +P P+
Sbjct: 145 PTTAATTPTTAATTPAAGAAAAAAPPPA 172


>SB_34189| Best HMM Match : MAM (HMM E-Value=5.60519e-45)
          Length = 649

 Score = 31.9 bits (69), Expect = 0.61
 Identities = 17/43 (39%), Positives = 23/43 (53%)
 Frame = +2

Query: 464 RPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHS 592
           +PP T+PSK     T P+  P++  TP T   T   +TK T S
Sbjct: 383 KPPTTTPSK----ATAPISDPMTTTTPTTTKATTPTTTKATAS 421


>SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 220

 Score = 31.5 bits (68), Expect = 0.80
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP--EEHPVLLTEAPLNPKANRE 429
           L+ P +  +VT+++  E++  H F +     P    HPV++TE   NP   R+
Sbjct: 131 LRTPFDRDVVTHYECQEQVLDHAFSHLGINTPGGVNHPVIMTEPVCNPNYCRQ 183


>SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 31.5 bits (68), Expect = 0.80
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -1

Query: 173 GNTARGASSPAKPALHIPEPLSTT 102
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_13911| Best HMM Match : PAN (HMM E-Value=0.033)
          Length = 534

 Score = 31.5 bits (68), Expect = 0.80
 Identities = 12/39 (30%), Positives = 25/39 (64%)
 Frame = +1

Query: 418 ANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIV 534
           A +E++ +I+   F   A+Y+  Q++L++Y+    +GIV
Sbjct: 420 AKKEELVEILLGYFRVQAVYLQEQSILAMYSYSAVSGIV 458


>SB_18097| Best HMM Match : NadA (HMM E-Value=2.2)
          Length = 272

 Score = 31.5 bits (68), Expect = 0.80
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 1/68 (1%)
 Frame = -3

Query: 321 VIPVSDDSVFDGVFEGQDTSFA-LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIIS 145
           V+PV   S  D     +  S   +C      V+LSH + H  M     D  +HG RS  S
Sbjct: 193 VVPVFKKSSKDNPENYRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFS 251

Query: 144 CETGLAHT 121
           CET L  T
Sbjct: 252 CETQLVPT 259


>SB_8780| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 172

 Score = 31.5 bits (68), Expect = 0.80
 Identities = 16/73 (21%), Positives = 30/73 (41%)
 Frame = -1

Query: 623 PAKSRRRMAWGSAYPS*MGTVWETPSPESSTIPVVRPDAYSESTAWMATYMAGVLNVSNM 444
           P+   +  +W    P    T W +PSP+  T     P    ++T+W +        +S++
Sbjct: 93  PSPQYKTTSWSLPLPQHKTTSWSSPSPKYKTTSWTSPSPQYKTTSWSSPLPQQTTFLSSL 152

Query: 443 IWVIFSLLALGLR 405
             +I  L  +  R
Sbjct: 153 YHIIGRLSGVHYR 165



 Score = 28.7 bits (61), Expect = 5.7
 Identities = 12/46 (26%), Positives = 19/46 (41%)
 Frame = -1

Query: 623 PAKSRRRMAWGSAYPS*MGTVWETPSPESSTIPVVRPDAYSESTAW 486
           P    +     S +P    T W +PSP+  T     P    ++T+W
Sbjct: 57  PLSQYKTTFMSSTFPQHKTTSWTSPSPQYKTTSWTSPSPQYKTTSW 102



 Score = 28.3 bits (60), Expect = 7.5
 Identities = 12/46 (26%), Positives = 19/46 (41%)
 Frame = -1

Query: 623 PAKSRRRMAWGSAYPS*MGTVWETPSPESSTIPVVRPDAYSESTAW 486
           P+   +  +W S  P    T W  P P+  T     P    ++T+W
Sbjct: 81  PSPQYKTTSWTSPSPQYKTTSWSLPLPQHKTTSWSSPSPKYKTTSW 126


>SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)
          Length = 170

 Score = 31.5 bits (68), Expect = 0.80
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -1

Query: 173 GNTARGASSPAKPALHIPEPLSTT 102
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_21074| Best HMM Match : NadA (HMM E-Value=2)
          Length = 358

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 1/68 (1%)
 Frame = -3

Query: 321 VIPVSDDSVFDGVFEGQDTSFA-LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIIS 145
           V+PV   S  D     +  S   +C      V+LSH + H  M     D  +HG RS  S
Sbjct: 251 VVPVFKKSSKDNPENYRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFS 309

Query: 144 CETGLAHT 121
           CET L  T
Sbjct: 310 CETQLVLT 317


>SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 402

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 1/68 (1%)
 Frame = -3

Query: 321 VIPVSDDSVFDGVFEGQDTSFA-LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIIS 145
           V+PV   S  D     +  S   +C      V+LSH + H  M     D  +HG RS  S
Sbjct: 71  VVPVFKKSSKDNPENYRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFS 129

Query: 144 CETGLAHT 121
           CET L  T
Sbjct: 130 CETQLVLT 137


>SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 458

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 1/68 (1%)
 Frame = -3

Query: 321 VIPVSDDSVFDGVFEGQDTSFA-LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIIS 145
           V+PV   S  D     +  S   +C      V+LSH + H  M     D  +HG RS  S
Sbjct: 105 VVPVFKKSSKDNPENYRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFS 163

Query: 144 CETGLAHT 121
           CET L  T
Sbjct: 164 CETQLVLT 171


>SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 591

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 1/68 (1%)
 Frame = -3

Query: 321 VIPVSDDSVFDGVFEGQDTSFA-LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIIS 145
           V+PV   S  D     +  S   +C      V+LSH + H  M     D  +HG RS  S
Sbjct: 388 VVPVFKKSGKDNPENYRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFS 446

Query: 144 CETGLAHT 121
           CET L  T
Sbjct: 447 CETQLVLT 454


>SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8)
          Length = 339

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 24/68 (35%), Positives = 30/68 (44%), Gaps = 1/68 (1%)
 Frame = -3

Query: 321 VIPVSDDSVFDGVFEGQDTSFA-LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIIS 145
           V+PV   S  D     +  S   +C      V+LSH + H  M     D  +HG RS  S
Sbjct: 229 VVPVFKKSGKDNPENYRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFS 287

Query: 144 CETGLAHT 121
           CET L  T
Sbjct: 288 CETQLVLT 295


>SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75)
          Length = 568

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 3/52 (5%)
 Frame = +2

Query: 455 HSTRPPCTSP--SKPCSRCTRPVVPPVSCWTPATVSP-TPCPSTKDTHSPTP 601
           H+T+PP T P  +KP +   R   PP +   P T  P T  P T   H+  P
Sbjct: 137 HTTKPPTTKPQTTKPHTTKPRTTKPPTT--KPHTTKPHTTKPHTTKPHTTKP 186


>SB_43551| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.027)
          Length = 466

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 31/115 (26%), Positives = 52/115 (45%), Gaps = 9/115 (7%)
 Frame = -1

Query: 563 VWE--TPSPESSTIPVVRPD-------AYSESTAWMATYMAGVLNVSNMIWVIFSLLALG 411
           VWE  T  P + T+P +  D        Y  S +W+      VL   N ++++F   +LG
Sbjct: 3   VWELSTTGPTNRTVPTIIIDYAICTEVLYKTSGSWIRICDI-VLLAPNAMFMVFLFYSLG 61

Query: 410 LRGASVSRTGCSSGATRSSL*KV*CQIFSMSSQLVTIPCSMGYLRVRIPLLLCAS 246
           L  A +  T C    T  +L  +    ++++SQ+  + C +   R    +LL AS
Sbjct: 62  LAHAKLVGTRCPIVKTIYTLLLLYGIHYTLNSQVFAV-CVVSVARCFASMLLTAS 115


>SB_13398| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2149

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%)
 Frame = +2

Query: 476  TSPSKPCSRCTRPVVPPVSCWTPATVSP-TPCPSTK 580
            +SP KP    T+PVVP      P+ + P  P PS+K
Sbjct: 1511 SSPPKPVKPSTKPVVPVKPVKPPSPIKPKPPIPSSK 1546


>SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28)
          Length = 570

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 23/68 (33%), Positives = 30/68 (44%), Gaps = 1/68 (1%)
 Frame = -3

Query: 321 VIPVSDDSVFDGVFEGQDTSFA-LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIIS 145
           V+PV   S  D     +  S   +C      ++LSH + H  M     D  +HG RS  S
Sbjct: 153 VVPVFKKSSKDNPENYRPISLTCICCKVMEHIVLSHLNSHTAMNNILSDL-QHGFRSGFS 211

Query: 144 CETGLAHT 121
           CET L  T
Sbjct: 212 CETQLVLT 219


>SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28)
          Length = 419

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 4/80 (5%)
 Frame = -3

Query: 348 EGMMPNL---LHVIPVSDDSVFDGVFEGQDTSFA-LCLISYIRVLLSHTDHHALMAGPSH 181
           EG +P +     V+PV   S  D     +  S   +C      ++LSH + H L A    
Sbjct: 210 EGTLPKIWLNAMVVPVHKKSAKDQPQNYRPISLTCICCKIMEHIVLSHLNKH-LAANNIL 268

Query: 180 DRGEHGARSIISCETGLAHT 121
              +HG R  +SCET L  T
Sbjct: 269 SIFQHGFRQALSCETQLVLT 288


>SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 749

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = -1

Query: 173 GNTARGASSPAKPALHIPEPLSTT 102
           GNT R    PAKP+L++P P S T
Sbjct: 540 GNTNRRTRIPAKPSLNLPSPPSKT 563


>SB_10843| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1259

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 14/31 (45%), Positives = 16/31 (51%)
 Frame = +3

Query: 402 SPQPQGQQREDDPDHVRNIQHARHVRRHPSR 494
           SP P+   R D+P  V     A HV  HPSR
Sbjct: 265 SPTPKRCVRFDEPPTVEKYSKASHVTEHPSR 295


>SB_8336| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.84)
          Length = 509

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 1/51 (1%)
 Frame = +2

Query: 455 HSTRPPCT-SPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           H  RPP   S   P +R T P  P  +   PAT +PT   +T    + TP+
Sbjct: 27  HHQRPPLLPSQQLPHNRTTTPTTPTTTT-PPATTTPTKPTNTTPPATTTPT 76



 Score = 29.5 bits (63), Expect = 3.2
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 3/52 (5%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSR---CTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           +T P  T+P+KP +     T     P +   PAT +PT   +T    + TP+
Sbjct: 137 TTPPATTTPTKPTTTTPPATTTPTKPTTTTPPATTTPTKSTTTTPPATTTPT 188



 Score = 29.1 bits (62), Expect = 4.3
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 5/60 (8%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSR---CTRPVVPPVSCWTPATVSPT-PCPSTKD-THSPTPSCVWT*P 622
           +T P  T+P+KP +     T     P +   PAT +PT P  +T   T +PT S   T P
Sbjct: 123 TTPPGTTTPTKPTTTTPPATTTPTKPTTTTPPATTTPTKPTTTTPPATTTPTKSTTTTPP 182



 Score = 28.3 bits (60), Expect = 7.5
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 4/53 (7%)
 Frame = +2

Query: 458 STRPPC-TSPSKPCSR---CTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           +T PP  T+P+KP +     T     P +   PAT +PT   +T    + TP+
Sbjct: 52  TTTPPATTTPTKPTNTTPPATTTPTKPTTTTPPATTTPTTPTTTTPPATTTPT 104



 Score = 28.3 bits (60), Expect = 7.5
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 3/52 (5%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRC---TRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           +T P  T+P+KP +     T     P +   PAT +PT   +T    + TP+
Sbjct: 109 TTPPATTTPTKPTTTTPPGTTTPTKPTTTTPPATTTPTKPTTTTPPATTTPT 160


>SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)
          Length = 330

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 4/80 (5%)
 Frame = -3

Query: 348 EGMMPNL---LHVIPVSDDSVFDGVFEGQDTSFA-LCLISYIRVLLSHTDHHALMAGPSH 181
           EG +P +     V+PV   S  D     +  S   +C      ++LSH + H L A    
Sbjct: 71  EGTLPKIWLNAMVVPVHKKSAKDQPQNYRPISLTCICCKIMEHIVLSHLNKH-LAANNIL 129

Query: 180 DRGEHGARSIISCETGLAHT 121
              +HG R  +SCET L  T
Sbjct: 130 SIFQHGFRQALSCETQLVLT 149


>SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2396

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 4/80 (5%)
 Frame = -3

Query: 348  EGMMPNL---LHVIPVSDDSVFDGVFEGQDTSFA-LCLISYIRVLLSHTDHHALMAGPSH 181
            EG +P +     V+PV   S  D     +  S   +C      ++LSH + H L A    
Sbjct: 1609 EGTLPKIWLNAMVVPVHKKSAKDQPQNYRPISLTCICCKIMEHIVLSHLNKH-LAANNIL 1667

Query: 180  DRGEHGARSIISCETGLAHT 121
               +HG R  +SCET L  T
Sbjct: 1668 SIFQHGFRQALSCETQLVLT 1687


>SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 859

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 4/80 (5%)
 Frame = -3

Query: 348 EGMMPNL---LHVIPVSDDSVFDGVFEGQDTSFA-LCLISYIRVLLSHTDHHALMAGPSH 181
           EG +P +     V+PV   S  D     +  S   +C      ++LSH + H L A    
Sbjct: 637 EGTLPKIWLNAMVVPVHKKSAKDQPQNYRPISLTCICCKIMEHIVLSHLNKH-LAANNIL 695

Query: 180 DRGEHGARSIISCETGLAHT 121
              +HG R  +SCET L  T
Sbjct: 696 SIFQHGFRQALSCETQLVLT 715


>SB_27518| Best HMM Match : RWD (HMM E-Value=0.015)
          Length = 277

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 9/15 (60%), Positives = 13/15 (86%)
 Frame = +2

Query: 482 PSKPCSRCTRPVVPP 526
           P++PCS CT+P +PP
Sbjct: 220 PTEPCSLCTKPALPP 234


>SB_23053| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 497

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 23/83 (27%), Positives = 29/83 (34%)
 Frame = +3

Query: 399 GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLR 578
           G     G  +   PDH   +      R  P   L V  R+   +  GL +R  PH     
Sbjct: 320 GPDHTHGVSKRTAPDHPLGLSK----RTAPDHTLGVSKRTAPDHPHGLSKRTAPHHPLGL 375

Query: 579 RIRTPPRHPASGLSRSRPHRLPH 647
              T P HP     R+ P   PH
Sbjct: 376 SKSTAPDHPHGVSKRTAPDH-PH 397



 Score = 29.5 bits (63), Expect = 3.2
 Identities = 20/71 (28%), Positives = 30/71 (42%)
 Frame = +3

Query: 411 PQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRT 590
           P G  +   PDH   +  ++H    P   L +  R+   +  G+ +R  PH        T
Sbjct: 192 PHGVSKRTAPDHPHGV--SKHTA--PDHTLGLSKRTGPDHTHGVSKRTAPHHPLGLSKHT 247

Query: 591 PPRHPASGLSR 623
            P HP  GLS+
Sbjct: 248 APDHP-HGLSK 257


>SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27)
          Length = 1492

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 4/80 (5%)
 Frame = -3

Query: 348  EGMMPNL---LHVIPVSDDSVFDGVFEGQDTSFA-LCLISYIRVLLSHTDHHALMAGPSH 181
            EG +P +     V+PV   S  D     +  S   +C      ++LSH + H L A    
Sbjct: 1047 EGTLPKIWLNAMVVPVHKKSAKDQPQNYRPISLTCICCKIMEHIVLSHLNKH-LAANNIL 1105

Query: 180  DRGEHGARSIISCETGLAHT 121
               +HG R  +SCET L  T
Sbjct: 1106 SIFQHGFRQALSCETQLVLT 1125


>SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)
          Length = 330

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 4/80 (5%)
 Frame = -3

Query: 348 EGMMPNL---LHVIPVSDDSVFDGVFEGQDTSFA-LCLISYIRVLLSHTDHHALMAGPSH 181
           EG +P +     V+PV   S  D     +  S   +C      ++LSH + H L A    
Sbjct: 71  EGTLPKIWLNAMVVPVHKKSAKDQPQNYRPISLTCICCKIMEHIVLSHLNKH-LAANNIL 129

Query: 180 DRGEHGARSIISCETGLAHT 121
              +HG R  +SCET L  T
Sbjct: 130 SIFQHGFRQALSCETQLVLT 149


>SB_52278| Best HMM Match : Ery_res_leader1 (HMM E-Value=0.94)
          Length = 592

 Score = 29.9 bits (64), Expect = 2.5
 Identities = 30/103 (29%), Positives = 37/103 (35%)
 Frame = +3

Query: 459 QHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRPHR 638
           Q     RRHP      R R+    + G+R R  P    +RR RT  R  +    R R H 
Sbjct: 356 QRGERERRHPPGVAICRYRTRQVSQRGVRERRNPPGVAIRRYRT--RQVSQRGERERRHH 413

Query: 639 LPHEDPHRARLLVHYHRRAGNRS*HQGEAVLRRS*LRAGNGHR 767
            P     R R      R    R  H G A+ R    + G   R
Sbjct: 414 -PGVAICRYRTRQVSQRGKRERRHHPGVAICRYRTRQTGESTR 455


>SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4)
          Length = 1439

 Score = 29.9 bits (64), Expect = 2.5
 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 1/46 (2%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRP-VVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           PP T P+ P S    P  VP  +   P  V+P P      +  PTP
Sbjct: 332 PPVTEPAPPSSVVAPPPAVPTPATAPPPVVAPPPSVFASSSGVPTP 377


>SB_58934| Best HMM Match : TPR_1 (HMM E-Value=3.8e-37)
          Length = 1632

 Score = 29.9 bits (64), Expect = 2.5
 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 5/38 (13%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVS-----CWTPATVSPTPC 568
           PC  P  PC     P V PV      C  P  V+ TPC
Sbjct: 551 PCVDPVTPCVDPVTPYVDPVKVSVTPCVDPVKVAVTPC 588



 Score = 28.7 bits (61), Expect = 5.7
 Identities = 13/35 (37%), Positives = 13/35 (37%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPS 574
           PC  P  PC     P V PV       V P   PS
Sbjct: 376 PCVDPVTPCVDPVTPYVDPVKVAVTPCVDPVKVPS 410


>SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 181

 Score = 29.9 bits (64), Expect = 2.5
 Identities = 18/45 (40%), Positives = 22/45 (48%)
 Frame = -3

Query: 255 LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 121
           +C      V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 94  ICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 137


>SB_36880| Best HMM Match : DUF1337 (HMM E-Value=0.54)
          Length = 367

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 16/49 (32%), Positives = 25/49 (51%)
 Frame = +3

Query: 441 DHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIR 587
           DH + I+    V RH    L  R R+ H +R  L+ +   H+A LR ++
Sbjct: 277 DHTQKIKEENKVLRHELLMLIRRTRALHEHREELQAQ---HKALLREVQ 322


>SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1831

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 14/34 (41%), Positives = 20/34 (58%)
 Frame = +2

Query: 503 CTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           C+RP  PPV+  T +T S T   +T  T + TP+
Sbjct: 620 CSRPTTPPVTT-TKSTTSSTTKGTTASTTTSTPT 652


>SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062)
          Length = 406

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 5/55 (9%)
 Frame = +2

Query: 452 KHSTRPPCTSPSKPCSRCTRPVVPPVSC----WTPAT-VSPTPCPSTKDTHSPTP 601
           KH + P    PS P S     ++P +        P T + PTP P T    +PTP
Sbjct: 205 KHPSYPSYKHPSYPSSHIQASLLPHIQASLLPLIPNTSIPPTPTPHTSIPPTPTP 259


>SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2)
          Length = 329

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 1/68 (1%)
 Frame = -3

Query: 321 VIPVSDDSVFDGVFEGQDTSFA-LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIIS 145
           V+PV   S  D     +  S   +C      ++LSH + H L A       +HG R  +S
Sbjct: 204 VVPVHKKSAKDQPQNYRPISLTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALS 262

Query: 144 CETGLAHT 121
           CET L  T
Sbjct: 263 CETQLVLT 270


>SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39)
          Length = 452

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 1/68 (1%)
 Frame = -3

Query: 321 VIPVSDDSVFDGVFEGQDTSFA-LCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIIS 145
           V+PV   S  D     +  S   +C      ++LSH + H L A       +HG R  +S
Sbjct: 2   VVPVHKKSAKDQPQNYRPISLTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALS 60

Query: 144 CETGLAHT 121
           CET L  T
Sbjct: 61  CETQLVLT 68


>SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 548

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 26/77 (33%), Positives = 38/77 (49%)
 Frame = +3

Query: 477 RRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRPHRLPHEDP 656
           RR+ SR+ + R RS +R R+  R R        R+ R+      S  SRSR +  P   P
Sbjct: 147 RRYRSRSDS-RPRSRYRGRSRSRSRDRYRERRPRKSRSKSLD-RSRRSRSRSYSRPSPSP 204

Query: 657 HRARLLVHYHRRAGNRS 707
           +R+R      RR+ +RS
Sbjct: 205 YRSRRSRSRTRRSRSRS 221


>SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40)
          Length = 892

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 5/69 (7%)
 Frame = -3

Query: 261 FALCLISYI--RVLLSHTDHHALMAGPSHDRGEHGARSIISCETGL---AHTGAIVYYQR 97
           FA CL   +   V+LSH + H L A       +HG R+  SCET L    H  A +  + 
Sbjct: 462 FATCLACKVMKHVVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKH 520

Query: 96  GNFFVAHLE 70
           G   V  L+
Sbjct: 521 GQVDVLLLD 529


>SB_28336| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 376

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 12/43 (27%), Positives = 23/43 (53%)
 Frame = +1

Query: 406 LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIV 534
           + PK    ++  ++F  F  P M +A++    + A+G  TGI+
Sbjct: 174 ITPKRATSQIIFVLFCIFGLPVMMLALKTAGDIIAAGLKTGII 216


>SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74)
          Length = 483

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 14/46 (30%), Positives = 20/46 (43%)
 Frame = +2

Query: 464 RPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           RPP     + C+ C      P +   P T  PTP P +  + +P P
Sbjct: 135 RPPVCPCKQECNFCCIEEEKPTTTKKPTT-KPTPAPHSSPSPTPPP 179


>SB_19751| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2644

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 1/47 (2%)
 Frame = +2

Query: 476  TSPSKPCS-RCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVW 613
            T P  P + + T P   P    T  TV PT  PS  D    T  C W
Sbjct: 1691 TCPITPVNAKPTNPWTTPAPSPTATTVGPTLAPSQWDCSFETNLCSW 1737


>SB_6983| Best HMM Match : rve (HMM E-Value=0.011)
          Length = 251

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +2

Query: 506 TRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCV 610
           T  VVPP+    P  V P+P  +  +  SPTPSC+
Sbjct: 207 TPAVVPPI----PTLVVPSPL-TQPEVESPTPSCI 236


>SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2735

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 21/75 (28%), Positives = 36/75 (48%)
 Frame = +3

Query: 405 PQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRI 584
           PQ  G   EDD D+V+    ++  +RH +   +V+  S    RA   RR    R  +R  
Sbjct: 647 PQVDGANDEDDTDNVQLESRSQGQQRHSNSKSSVQSSSELVKRARTTRRLGVSRVKIRVS 706

Query: 585 RTPPRHPASGLSRSR 629
           +T  + P+   +R++
Sbjct: 707 QTHSQ-PSQATARTQ 720


>SB_46336| Best HMM Match : DUF1518 (HMM E-Value=5.6)
          Length = 187

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 2/50 (4%)
 Frame = +2

Query: 482 PSKPCSRCTRPV--VPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*PV 625
           PS P S    PV  V      T  T +PT C  T   +   P+C+   PV
Sbjct: 85  PSSPVSPLPSPVPAVAATPSQTYCTSTPTSCTPTTTCYLQVPTCILIPPV 134


>SB_42612| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 732

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 2/53 (3%)
 Frame = +2

Query: 452 KHSTRPPCTSPSKPCSRCT--RPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           K  TRP  TS +   S+    RP   P++  +P   S +  P+  D HSPT S
Sbjct: 428 KPVTRPKTTSGTLSVSKSIPPRPSTEPITTSSPYRHSWSYVPNFVDYHSPTSS 480


>SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05)
          Length = 2200

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 4/64 (6%)
 Frame = +3

Query: 456  IQHARHVRRHPSRALAVRVRSYHRYRAGLRRRC---LPHRAHLRRIRT-PPRHPASGLSR 623
            I H++   RH S+ L  R R  HR +    RR    + H ++L R R   P   ++ +  
Sbjct: 1588 IHHSKEYYRHSSKILKSRTRHLHRVKKYWHRRINHKINHISNLLRPRNWVPPFNSTAMIF 1647

Query: 624  SRPH 635
             +PH
Sbjct: 1648 GKPH 1651


>SB_11585| Best HMM Match : TPR_MLP1_2 (HMM E-Value=2.2)
          Length = 610

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +2

Query: 479 SPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTP 601
           +PS+  S    PV    S  +  T++  P P + DT SPTP
Sbjct: 306 TPSRLVSLQNSPVKMMRSTLSAQTLAENPIPESTDTTSPTP 346


>SB_1754| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1521

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 22/61 (36%), Positives = 26/61 (42%), Gaps = 2/61 (3%)
 Frame = -1

Query: 557 ETPSPESSTIPVVRPDAYSESTAWMATYMAGVLNVSNMIWVIFSLLALG--LRGASVSRT 384
           ETPSP   + P   PDA    TAW    +   L  S  + V  S    G  LRGA   + 
Sbjct: 90  ETPSPALESAPAAMPDA--TDTAWTCLIVTYYLE-SEALHVSASASRSGRRLRGADAGKR 146

Query: 383 G 381
           G
Sbjct: 147 G 147


>SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42)
          Length = 382

 Score = 28.3 bits (60), Expect = 7.5
 Identities = 14/40 (35%), Positives = 18/40 (45%)
 Frame = +2

Query: 503 CTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
           CT    P ++   P T + T  P TK    P PS + T P
Sbjct: 150 CTGTPEPTITSKPPVTETTTTKPETKPPKPPAPSTIPTPP 189


>SB_34370| Best HMM Match : DUF1656 (HMM E-Value=0.59)
          Length = 764

 Score = 28.3 bits (60), Expect = 7.5
 Identities = 22/57 (38%), Positives = 28/57 (49%), Gaps = 1/57 (1%)
 Frame = +3

Query: 435 DPDHV-RNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRH 602
           DP HV R    +RHVRR PS +  VR ++       +RR  L  R H+R      RH
Sbjct: 224 DPRHVKRKTLDSRHVRRKPSDSRHVRRKTLDSRH--VRRNTLDSR-HVRCNTLDSRH 277


>SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.3 bits (60), Expect = 7.5
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = -1

Query: 173 GNTARGASSPAKPALHIPEPLSTT 102
           GNT R     AKPAL++P P S T
Sbjct: 40  GNTNRRTRIQAKPALNLPSPPSKT 63


>SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 635

 Score = 28.3 bits (60), Expect = 7.5
 Identities = 13/24 (54%), Positives = 14/24 (58%)
 Frame = -1

Query: 173 GNTARGASSPAKPALHIPEPLSTT 102
           GNT R    PAKP L IP P + T
Sbjct: 68  GNTNRRTRIPAKPTLTIPSPPTKT 91


>SB_10665| Best HMM Match : PT (HMM E-Value=6.2)
          Length = 215

 Score = 28.3 bits (60), Expect = 7.5
 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 1/35 (2%)
 Frame = +3

Query: 558 PHRAHLRRIRTPPR-HPASGLSRSRPHRLPHEDPH 659
           PHR H+   RTP R H     +   PH  P  +PH
Sbjct: 161 PHRPHMDPTRTPHRPHMDPTRTSHGPHTDPTRNPH 195


>SB_8208| Best HMM Match : ShTK (HMM E-Value=1.2e-21)
          Length = 226

 Score = 28.3 bits (60), Expect = 7.5
 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 2/53 (3%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVS--CWTPATVSPTPCPSTKDTHSPT 598
           C +H T        K C  C +   PP+     T  T +PT  P TK T +PT
Sbjct: 167 CRRHKTYMNIYC-RKSCGFCGKAPHPPIQEPPVTKTTTAPTEPPVTKTTTAPT 218


>SB_36012| Best HMM Match : DUF755 (HMM E-Value=0.064)
          Length = 265

 Score = 28.3 bits (60), Expect = 7.5
 Identities = 23/89 (25%), Positives = 32/89 (35%), Gaps = 3/89 (3%)
 Frame = +3

Query: 399 GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLR 578
           G P       ED  D     +  ++  R  S     +     R+++  + R    R H R
Sbjct: 82  GGPSRHNNASEDSFDSGEEEKRNKNSARKMSPINGHKSSRKSRHKSDKKERASRKRRHSR 141

Query: 579 RIRTPPRHPASGLS--RSRPHRL-PHEDP 656
               P RHP+   S  R R  RL  H  P
Sbjct: 142 SESPPVRHPSGSQSGDRQRERRLHKHSSP 170


>SB_7840| Best HMM Match : S-antigen (HMM E-Value=0.11)
          Length = 231

 Score = 28.3 bits (60), Expect = 7.5
 Identities = 29/101 (28%), Positives = 42/101 (41%), Gaps = 6/101 (5%)
 Frame = -3

Query: 753 LLEVKSDVAQLLLDVTNDFPLGGGSERVAALGEDLHEVVCEVATG*VQTQDGVGECVS-- 580
           ++ V   V  ++L V +    G G + +  + +D    V + A G V    GVG+     
Sbjct: 16  VVSVMMVVLVMMLMVRDSDDGGVGDDAIGRVSDD--GGVGDDADGRVSDDGGVGDDADGR 73

Query: 579 FVDGHGVGDTVAGVQHDTGG----TTGRVQREHGLDGDVHG 469
             D  GVGD   G   D GG      GRV  + G+  D  G
Sbjct: 74  VSDDGGVGDDADGRVSDDGGVGDNAEGRVSDDGGVGDDAIG 114


>SB_41475| Best HMM Match : HSA (HMM E-Value=7.5)
          Length = 195

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 19/76 (25%), Positives = 25/76 (32%)
 Frame = +3

Query: 444 HVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSR 623
           H   +      R H  R    RVR  H YR         HR H  R+     +    +  
Sbjct: 119 HEYRVHRVHEYRVH--RVHEYRVRRVHEYRVHRVHEYRVHRVHEYRVHRVHEYRVHRVHE 176

Query: 624 SRPHRLPHEDPHRARL 671
            R HR+     HR  +
Sbjct: 177 YRVHRVHEYRVHRVHV 192


>SB_30534| Best HMM Match : EGF (HMM E-Value=0.12)
          Length = 521

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 14/44 (31%), Positives = 21/44 (47%)
 Frame = +2

Query: 449 SKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTK 580
           S+ ST+ P T   KP +   RP+  P +   P   +  P P T+
Sbjct: 252 SQVSTKQPATERPKPRTEKPRPITQPPTTQRPRPKTRRPEPRTE 295


>SB_20112| Best HMM Match : EGF (HMM E-Value=0)
          Length = 2112

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 17/52 (32%), Positives = 23/52 (44%)
 Frame = +2

Query: 452  KHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
            KH T PP        S  + P   P+S  TP+  SP    S+  +HS   +C
Sbjct: 2062 KHHT-PPSAHSYGTSSYDSSPQKLPISYLTPSPESPKDWSSSPSSHSDWSNC 2112


>SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06)
          Length = 295

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 13/33 (39%), Positives = 16/33 (48%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTP 565
           PP  +P+ P    T P VPP +   P T  P P
Sbjct: 227 PPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259


>SB_3565| Best HMM Match : ASC (HMM E-Value=1.1e-12)
          Length = 575

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 1/45 (2%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTP-ATVSPTPCPSTKDTHSPT 598
           PP T+P         P   P +  T  AT  PT  P+T  T  PT
Sbjct: 1   PPVTTPVPTTESTAVPTTAPTTEQTTVATTIPTTIPTTVPTTEPT 45


>SB_40582| Best HMM Match : Kazal_1 (HMM E-Value=0)
          Length = 1568

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 13/40 (32%), Positives = 15/40 (37%)
 Frame = +2

Query: 488 KPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSC 607
           K    C R  VPPVS  +P      PC        P  +C
Sbjct: 637 KAFGECGRTTVPPVSTSSPTPTPQDPCTGFNCDTPPYSTC 676


>SB_38165| Best HMM Match : Drf_FH1 (HMM E-Value=1)
          Length = 231

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 1/54 (1%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPAT-VSPTPCPSTKDTHSPTPS 604
           C+   T  P  +P+   +  T     P + +TP T  +PTP  +   +++PTPS
Sbjct: 40  CTTSYTPTPSYTPTPSYTPTTS--YTPTTSYTPTTSYTPTPSYTPTTSYTPTPS 91


>SB_11044| Best HMM Match : FMO-like (HMM E-Value=3.4)
          Length = 781

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 14/49 (28%), Positives = 22/49 (44%)
 Frame = +2

Query: 470 PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
           P  +P+ P S+ T    PP+   TP  +  TP P+ +   +  P    T
Sbjct: 19  PAPTPTTPTSQATTASGPPII--TPIPLKETPTPALESAPAAMPDATDT 65


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,823,424
Number of Sequences: 59808
Number of extensions: 714565
Number of successful extensions: 3057
Number of sequences better than 10.0: 90
Number of HSP's better than 10.0 without gapping: 2423
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2981
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2167838629
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).