SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0019
         (837 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014)          33   0.22 
SB_29838| Best HMM Match : EGF (HMM E-Value=1.2e-15)                   30   2.0  
SB_32468| Best HMM Match : Drf_FH1 (HMM E-Value=2.6)                   29   3.5  
SB_13883| Best HMM Match : 7tm_1 (HMM E-Value=6e-08)                   29   6.2  
SB_8479| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   6.2  
SB_20998| Best HMM Match : Extensin_2 (HMM E-Value=0.002)              28   8.2  
SB_16478| Best HMM Match : C2 (HMM E-Value=2.2e-13)                    28   8.2  
SB_18929| Best HMM Match : BRCT (HMM E-Value=1.4e-08)                  28   8.2  

>SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014)
          Length = 735

 Score = 33.5 bits (73), Expect = 0.22
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = +1

Query: 46  PTIGRTYVYDNKYYKNLGCLIKNAKRKKHLVEHEQEEKQWDLLDNYMVAE 195
           PT  RT+  D+K   ++  L+K  K +   + +E E K+W  L NYM AE
Sbjct: 87  PTFARTFAVDSKVTPSVIALLKQFKWEIVAIIYE-EWKKWVQLKNYMKAE 135


>SB_29838| Best HMM Match : EGF (HMM E-Value=1.2e-15)
          Length = 373

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 5/81 (6%)
 Frame = +3

Query: 42  HPHHRAYLRVRQ*ILQKLGLSYQKRQAQEAPSRT*TRGEAMGSSRQLHGCRRSLFRTGQK 221
           H + R+Y    +   ++LG S   +  +   ++     ++  +S  + GC  SL   GQ 
Sbjct: 19  HRNTRSYRTKSRFSAKRLGKSRNIKNRKSVRTKL---QDSRNNSTAIFGCNMSLLNKGQS 75

Query: 222 PKT---YPF*RNS-QC-ETRY 269
           PK+   +PF R++ QC E+RY
Sbjct: 76  PKSRRVHPFARHAGQCAESRY 96


>SB_32468| Best HMM Match : Drf_FH1 (HMM E-Value=2.6)
          Length = 416

 Score = 29.5 bits (63), Expect = 3.5
 Identities = 13/48 (27%), Positives = 22/48 (45%)
 Frame = -3

Query: 217 CPVLKRDLRQPCSCLEDPIASPLVHVRLGASCAWRF**DSPSFCNIYC 74
           CP + R +  PC  ++ P++ P  +V    S    +   + S C  YC
Sbjct: 71  CPYVNRTVSVPCPYVKRPVSVPCPYVNRAVSVPCPYVNRAVSVCQPYC 118


>SB_13883| Best HMM Match : 7tm_1 (HMM E-Value=6e-08)
          Length = 535

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 17/63 (26%), Positives = 27/63 (42%)
 Frame = +1

Query: 475 EVIRIVEPSYVGMNNEYRISLAKKGGGCPIMNIHSEYTNSFESFVNRVIWENFYKPIVYI 654
           E I +    ++  NN   +   +  GG    +  +E   S E+  N V WEN    + YI
Sbjct: 101 ETINVTGNYWLPSNNVLELKYLRDIGGVTWTDNCAECCLSKETSQNSVTWENLRSEMYYI 160

Query: 655 GTD 663
           G +
Sbjct: 161 GIE 163


>SB_8479| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 548

 Score = 28.7 bits (61), Expect = 6.2
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 2/35 (5%)
 Frame = +2

Query: 380 TSSPTSNPHAPTGATSSSLNTLLGGKKTT--CPTK 478
           T S T  P  PT + +SS  +  GG KTT  C T+
Sbjct: 353 TGSRTRTPPTPTSSRASSRGSARGGAKTTKKCTTR 387


>SB_20998| Best HMM Match : Extensin_2 (HMM E-Value=0.002)
          Length = 765

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +2

Query: 389 PTSNPHAPTGATSSSLNTLLGGKKTTCPT 475
           P S  H+P  +T  S+NT+L  +   CP+
Sbjct: 703 PVSRYHSPRPSTCLSINTILHDQARACPS 731


>SB_16478| Best HMM Match : C2 (HMM E-Value=2.2e-13)
          Length = 186

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 3/73 (4%)
 Frame = +1

Query: 226 KLTLF-KEIRSVKPDTM--KLIVNWSGKEFLRETWTRFVEDSFPIVNDQEVMDVYLVANL 396
           KL +F K+     PD +  ++++  S ++  RE W   +    PI     + + +   +L
Sbjct: 96  KLQIFVKQKLEGVPDKIMGRVVLGTSAEDLEREHWNEAMTAKKPIARWHSLREFH--NSL 153

Query: 397 KPTRPNRCYKFLA 435
            PTRPNR  K +A
Sbjct: 154 LPTRPNRTSKPIA 166


>SB_18929| Best HMM Match : BRCT (HMM E-Value=1.4e-08)
          Length = 1213

 Score = 28.3 bits (60), Expect = 8.2
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = +1

Query: 301 EFLRETWTRFVEDSFPIVNDQEVMDVYLVANLKPTR 408
           E  RET  R  E+ FP++   E+    L+  LK T+
Sbjct: 170 ESCRETGKRVAEELFPVIAQDELSTPLLMGKLKRTK 205


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,235,596
Number of Sequences: 59808
Number of extensions: 593545
Number of successful extensions: 1857
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1622
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1856
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2359470773
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).