SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0018
         (929 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_15292| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_9953| Best HMM Match : VWA (HMM E-Value=0)                          31   1.0  
SB_43700| Best HMM Match : SRCR (HMM E-Value=0)                        31   1.8  
SB_2104| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   5.4  
SB_1625| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   7.1  
SB_39564| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.4  

>SB_15292| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 983

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 5/51 (9%)
 Frame = -1

Query: 593 KSGFSLARLRDGV----WRSG-SCLIWPRGMRLLEEGPRSPEQNIRYVYNF 456
           KSG   AR R G+    W +  SC +W  GMR++    RSP++ +R V  F
Sbjct: 357 KSGHLAARYRPGIARYTWSTVYSCSLW--GMRVVVPNHRSPQERVRKVRYF 405


>SB_9953| Best HMM Match : VWA (HMM E-Value=0)
          Length = 1034

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 16/67 (23%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = -3

Query: 834  WVFAHNICFRTTTTLKSDRVIASSSRRRELGAYRIH-SHISKSCSCLGRSLHFTCTPNVS 658
            W +   +        KSDR++   S R E+  Y IH +H+ +S S L  +  +   P+++
Sbjct: 815  WNYKEELSVEDGLLFKSDRIVVPRSMRAEVHVYLIHGAHMGESKS-LSLARDYVFWPSMT 873

Query: 657  CYLRMKI 637
             +++ ++
Sbjct: 874  AHIKDRV 880


>SB_43700| Best HMM Match : SRCR (HMM E-Value=0)
          Length = 967

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +2

Query: 476 CSVQVTSGPPPATSYLWAKSNKS 544
           CSV V SG PPATS+ W K ++S
Sbjct: 706 CSVLV-SGRPPATSFTWIKESQS 727


>SB_2104| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1219

 Score = 29.1 bits (62), Expect = 5.4
 Identities = 18/63 (28%), Positives = 28/63 (44%)
 Frame = -3

Query: 834 WVFAHNICFRTTTTLKSDRVIASSSRRRELGAYRIHSHISKSCSCLGRSLHFTCTPNVSC 655
           W +   I        K +RVI  SS R+ L + R+H+      +CL R+      P +S 
Sbjct: 521 WTYRDEISVYNGVLYKGERVIVPSSLRKTLMS-RVHASHQGEQACLRRARDALFLPEMSQ 579

Query: 654 YLR 646
            +R
Sbjct: 580 QIR 582


>SB_1625| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1018

 Score = 28.7 bits (61), Expect = 7.1
 Identities = 18/63 (28%), Positives = 28/63 (44%)
 Frame = -3

Query: 834 WVFAHNICFRTTTTLKSDRVIASSSRRRELGAYRIHSHISKSCSCLGRSLHFTCTPNVSC 655
           W +   I        K +RVI  SS R+ L + R+H+      +CL R+      P +S 
Sbjct: 722 WTYRDEISVYNGVLYKGERVIVPSSLRKTLMS-RVHASHQGEQACLRRARDALFWPGMSQ 780

Query: 654 YLR 646
            +R
Sbjct: 781 QIR 783


>SB_39564| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 279

 Score = 28.3 bits (60), Expect = 9.4
 Identities = 12/46 (26%), Positives = 25/46 (54%)
 Frame = -3

Query: 798 TTLKSDRVIASSSRRRELGAYRIHSHISKSCSCLGRSLHFTCTPNV 661
           T   + R + + ++ R L  +  H+H +++ + L +  H TCT N+
Sbjct: 134 TRHSTTRALHTHTQTRTLNMHTQHAHSARTLNTLTQHAHSTCTLNM 179


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,155,788
Number of Sequences: 59808
Number of extensions: 637736
Number of successful extensions: 1270
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1161
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1270
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2705204627
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).