SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0017
         (851 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_50360| Best HMM Match : efhand (HMM E-Value=2.5e-05)                29   3.6  
SB_59674| Best HMM Match : efhand (HMM E-Value=1.3e-18)                29   3.6  
SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   6.3  
SB_43997| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  
SB_13694| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.4  

>SB_50360| Best HMM Match : efhand (HMM E-Value=2.5e-05)
          Length = 363

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +3

Query: 261 LR*EKKKNNDDQRSRSPRYGDPIRPP-DTPRSQNQPAGS 374
           L+  KK+ +D +R  +P Y     PP DTP+  + P  S
Sbjct: 117 LKEAKKRLSDGERDPAPNYTPTEEPPKDTPKKSSSPENS 155


>SB_59674| Best HMM Match : efhand (HMM E-Value=1.3e-18)
          Length = 269

 Score = 29.5 bits (63), Expect = 3.6
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = +3

Query: 261 LR*EKKKNNDDQRSRSPRYGDPIRPP-DTPRSQNQPAGS 374
           L+  KK+ +D +R  +P Y     PP DTP+  + P  S
Sbjct: 221 LKEAKKRLSDGERDPAPNYTPTEEPPKDTPKKSSSPENS 259


>SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1361

 Score = 28.7 bits (61), Expect = 6.3
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +3

Query: 294 QRSRSPRYGDPIRPP-DTPRSQNQPAGSERDTPPTGLLLHSST*GNLTSLGQRQY 455
           +  R P  G P RPP D  +++  P+G E DT        SST G+L+S  Q+ Y
Sbjct: 143 EEKRKP--GRPGRPPKDASKTKTLPSGDEDDTE------SSSTEGDLSSSSQQFY 189


>SB_43997| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1067

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = +3

Query: 300 SRSPRYGDPIRPPDTPRSQNQPAGSERDTPPT 395
           S SP    P  PP +P S + P+ S    PP+
Sbjct: 143 SSSPSSSFPSVPPSSPPSSSSPSSSSPSVPPS 174


>SB_13694| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 767

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%)
 Frame = -2

Query: 478 LFYTPKGKYCRWPREVKLPYVLL-CKSNPVGG 386
           L Y  K K C WPR V  P   L C    VGG
Sbjct: 111 LLYNEKTKQCDWPRNVDCPMGNLDCGVGIVGG 142


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,965,847
Number of Sequences: 59808
Number of extensions: 517472
Number of successful extensions: 1444
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1287
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1437
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2419355818
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).