SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0016
         (985 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_32414| Best HMM Match : Osteopontin (HMM E-Value=2.4)               35   0.088
SB_50497| Best HMM Match : CH (HMM E-Value=0.0084)                     31   1.1  
SB_15028| Best HMM Match : Drf_FH1 (HMM E-Value=0.84)                  31   1.1  
SB_53200| Best HMM Match : Apolipoprotein (HMM E-Value=0.0069)         31   1.1  
SB_56769| Best HMM Match : UIM (HMM E-Value=0.0025)                    31   1.4  
SB_34673| Best HMM Match : UK (HMM E-Value=0.6)                        31   1.4  
SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14)        31   1.9  
SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029)              31   1.9  
SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.9  
SB_1740| Best HMM Match : Protamine_P2 (HMM E-Value=0.9)               31   1.9  
SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.9  
SB_12401| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.5  
SB_45191| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   3.3  
SB_28711| Best HMM Match : Peptidase_A16_N (HMM E-Value=3.7e-05)       30   3.3  
SB_16173| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   3.3  
SB_8277| Best HMM Match : DUF827 (HMM E-Value=1.7)                     30   3.3  
SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003)        30   3.3  
SB_44903| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   3.3  
SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   3.3  
SB_7511| Best HMM Match : Peptidase_A16_N (HMM E-Value=4.4e-05)        30   3.3  
SB_35030| Best HMM Match : Peptidase_A16_N (HMM E-Value=4.3e-05)       29   5.8  
SB_29938| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.8  
SB_54714| Best HMM Match : Peptidase_A16_N (HMM E-Value=2.8e-05)       29   5.8  
SB_52621| Best HMM Match : Peptidase_A16_N (HMM E-Value=2.4e-05)       29   5.8  
SB_50645| Best HMM Match : Syndecan (HMM E-Value=0.02)                 29   5.8  
SB_42797| Best HMM Match : Peptidase_A16_N (HMM E-Value=2e-05)         29   5.8  
SB_4582| Best HMM Match : Sas10_Utp3 (HMM E-Value=0.7)                 29   5.8  
SB_3564| Best HMM Match : DUF1525 (HMM E-Value=8.1)                    29   5.8  
SB_50916| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   7.6  
SB_39159| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   7.6  
SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   7.6  

>SB_32414| Best HMM Match : Osteopontin (HMM E-Value=2.4)
          Length = 777

 Score = 35.1 bits (77), Expect = 0.088
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +2

Query: 605 LSAETPSDSLDSNAEALQASATED---ILTTLPTEPVVQTPPLQEPAINETTRRTPKDDL 775
           +SA T S  L SN +   ++ T D   +++ LPT   +  PP   PA  +T    P D L
Sbjct: 276 ISAPTLSKLLSSNTQMHTSATTTDKVALVSNLPTPIAITPPPTTPPAEKKTVEVIP-DPL 334

Query: 776 SNDIETLLVE 805
           +  +E++  E
Sbjct: 335 AKRVESIATE 344


>SB_50497| Best HMM Match : CH (HMM E-Value=0.0084)
          Length = 2086

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +2

Query: 662  SATEDILTTLPTE-PVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQT 823
            S  E++ T +PTE P  +  P+Q   +  T+   P +DL   +E+   EI  VQ+
Sbjct: 1372 STVEEVPTDVPTESPSAEVKPVQSDIVESTSDEAPAEDL---VESHKEEIMPVQS 1423


>SB_15028| Best HMM Match : Drf_FH1 (HMM E-Value=0.84)
          Length = 944

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +2

Query: 662 SATEDILTTLPTE-PVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQT 823
           S  E++ T +PTE P  +  P+Q   +  T+   P +DL   +E+   EI  VQ+
Sbjct: 267 STVEEVPTDVPTESPSAEVKPVQSDIVESTSDEAPAEDL---VESHKEEIMPVQS 318


>SB_53200| Best HMM Match : Apolipoprotein (HMM E-Value=0.0069)
          Length = 246

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 28/87 (32%), Positives = 37/87 (42%)
 Frame = +2

Query: 608 SAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDI 787
           S ET  +SLD + E L  S  E  L TL          L E    ET   +  + L   +
Sbjct: 151 SLETLDESLDESLETLDESLDES-LETLDESLDESLETLDESL--ETLDESLDESLDESL 207

Query: 788 ETLLVEIRDVQTRLTDLPDESLEATEE 868
           ETL   + +    L +  DESLE  +E
Sbjct: 208 ETLDESLDESLETLDESLDESLEILDE 234



 Score = 29.9 bits (64), Expect = 3.3
 Identities = 26/93 (27%), Positives = 47/93 (50%)
 Frame = +2

Query: 590 DHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKD 769
           D S   S ET  +SL++  E+L+    ++ L TL  E + ++    + +++E+   T  +
Sbjct: 124 DESLDESLETLDESLETLDESLET--LDESLETLD-ESLDESLETLDESLDESLE-TLDE 179

Query: 770 DLSNDIETLLVEIRDVQTRLTDLPDESLEATEE 868
            L   +ETL   +  +   L +  DESLE  +E
Sbjct: 180 SLDESLETLDESLETLDESLDESLDESLETLDE 212


>SB_56769| Best HMM Match : UIM (HMM E-Value=0.0025)
          Length = 358

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 7/95 (7%)
 Frame = +2

Query: 647 EALQASATEDI--LTTLPTEPVVQTPP---LQEPAINETTRRTPKDDLSNDI--ETLLVE 805
           E +Q    E I  L+ +   P ++TP    +Q  ++    RRT    L+  +  E     
Sbjct: 63  ELIQTEVEEAIESLSQMVARPYLRTPRSHIIQATSLLANKRRTFLLALTRGLIPEEEPPA 122

Query: 806 IRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRS 910
           +  + +RLT LP  S    EE    ESN+N+VR++
Sbjct: 123 MERLVSRLTFLPMPSGSGDEESDEEESNYNEVRKA 157


>SB_34673| Best HMM Match : UK (HMM E-Value=0.6)
          Length = 641

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 19/65 (29%), Positives = 28/65 (43%)
 Frame = +2

Query: 740 NETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRA 919
           NE   RT +   + D         +   RLTD P  S E T+E +R +   N   RS + 
Sbjct: 337 NELPNRTQESTDTPDKPLESTHAPERPQRLTDSPYSSQEVTDEPNRLQKTINVPDRSQKT 396

Query: 920 VGAED 934
           + A +
Sbjct: 397 INAPE 401



 Score = 30.7 bits (66), Expect = 1.9
 Identities = 20/76 (26%), Positives = 31/76 (40%)
 Frame = +2

Query: 707 VQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRES 886
           V   P +   + ++  R  ++D + D      +  D     TD PD S EAT+E  R + 
Sbjct: 158 VTNTPDKPQEVTDSPDRLQEEDDAPDRPQEATDESDRSQEATDEPDRSHEATDEPDRPQE 217

Query: 887 NFNQVRRSSRAVGAED 934
             +   RS     A D
Sbjct: 218 TTDVPGRSQEVTNAPD 233


>SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14)
          Length = 1709

 Score = 30.7 bits (66), Expect = 1.9
 Identities = 17/64 (26%), Positives = 34/64 (53%), Gaps = 2/64 (3%)
 Frame = +2

Query: 725  QEPAINETTRR--TPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQ 898
            + PA N+      + K++  ND+E  L E++   TRL    +ES  +T ++ R   N ++
Sbjct: 1616 KNPASNDKAEEEASTKEERVNDLERKLDELQQSNTRLLKELEESQASTAKLQRNIHNMDK 1675

Query: 899  VRRS 910
             +++
Sbjct: 1676 AKQA 1679


>SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029)
          Length = 1866

 Score = 30.7 bits (66), Expect = 1.9
 Identities = 28/116 (24%), Positives = 53/116 (45%)
 Frame = +2

Query: 614  ETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIET 793
            E+PS   D+ +E  +A +   +L+   TEP   + PL +PAI  + +  PK  L+  I  
Sbjct: 1068 ESPSTDRDAESELPKAGSVSALLSVFATEP---SKPL-KPAIRYSRKNRPK-TLAVGIAP 1122

Query: 794  LLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDHGVPPEVEV 961
             +++    Q    ++ D + E   + +    +F+ VR S  +   E      E+ +
Sbjct: 1123 EILKAAREQVNRDEMRDRNREELRDRNITHDDFD-VRLSLPSTPTESEEAGQELHL 1177


>SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1438

 Score = 30.7 bits (66), Expect = 1.9
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 1/72 (1%)
 Frame = +2

Query: 608 SAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEP-AINETTRRTPKDDLSND 784
           +AE P +  D++ E  ++ A E  +     E  V+    +EP A+NE     PKD+    
Sbjct: 587 TAEVPIEDADTSTEEAESPAAEPEVAVKEAEAPVEDDAFEEPEALNEKA-EDPKDEDETQ 645

Query: 785 IETLLVEIRDVQ 820
            E   V I + +
Sbjct: 646 EEKAEVPIDEAE 657


>SB_1740| Best HMM Match : Protamine_P2 (HMM E-Value=0.9)
          Length = 268

 Score = 30.7 bits (66), Expect = 1.9
 Identities = 24/81 (29%), Positives = 37/81 (45%)
 Frame = +2

Query: 230 ESTPPIVKQNQPKEKPIDLNLKTDVKVDIENIRNDNKFWVEKHLYHDAECQYFLSMAKKS 409
           E+ P   K N+PK    DL+L  D   +++N  +D           +AE + F ++ K  
Sbjct: 37  ETDPSPEKANEPKSDVDDLHLPNDEN-EMDNDESDES-------EDEAETEEFGALEKAG 88

Query: 410 KPTSAVGDDFEVKDQNDKDRD 472
           K    V D     D+N+ DRD
Sbjct: 89  KEDKEVYDLDLPDDENEMDRD 109


>SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2656

 Score = 30.7 bits (66), Expect = 1.9
 Identities = 23/99 (23%), Positives = 38/99 (38%), Gaps = 2/99 (2%)
 Frame = +2

Query: 665  ATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSND--IETLLVEIRDVQTRLTDL 838
            ATE+   T  TE V+  PP Q  A        P+++LS    ++  L     ++  L   
Sbjct: 860  ATEEFTLTTNTEKVLTLPPTQASAQLLEASPQPREELSESLALDVPLEGESAIEYYLRQQ 919

Query: 839  PDESLEATEEVSRRESNFNQVRRSSRAVGAEDHGVPPEV 955
            P +       V  +       R+  +     DH +P +V
Sbjct: 920  PADDHSQQSNVEEQAMTATHNRKVDQESSTHDHHMPRDV 958


>SB_12401| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 30.3 bits (65), Expect = 2.5
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 2/67 (2%)
 Frame = +2

Query: 740 NETTRRTPKDDL--SNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSS 913
           +E  +   +DD+    D+E   V    ++T + +    +LEA EE SRR S  ++++  +
Sbjct: 47  DEVLKLMSRDDVFTEEDVEEETVNAGKIETTIRE-KILALEAAEETSRRNSVASEIQSEA 105

Query: 914 RAVGAED 934
            A  A+D
Sbjct: 106 AASSAQD 112


>SB_45191| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 453

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +3

Query: 324 FVTITNSGLKNIYTMTPNANISFQWPKNLNQHQPLEMI-LKSKIKMTRIGTL 476
           F T++ SG+ +          +  WP     HQPL+ + L++ + +TR GT+
Sbjct: 272 FATLSTSGIGSQRQQATQETGATDWPLT-QTHQPLDAVSLRTVLSLTRCGTI 322


>SB_28711| Best HMM Match : Peptidase_A16_N (HMM E-Value=3.7e-05)
          Length = 411

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
 Frame = +2

Query: 740 NETTRRTPKDDL--SNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSS 913
           +E      +DD+    D+E   V    ++T + +    +LEA EE SRR S  ++++  +
Sbjct: 47  DEVLELMSRDDVFTEEDVEEETVNAGKIETNIRE-KILALEAAEETSRRNSVASEIQSEA 105

Query: 914 RAVGAED 934
            A  A+D
Sbjct: 106 AASSAQD 112


>SB_16173| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
 Frame = +2

Query: 740 NETTRRTPKDDL--SNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSS 913
           +E      +DD+    D+E   V    ++T + +    +LEA EE SRR S  ++++  +
Sbjct: 47  DEVLELMSRDDVFTEEDVEEETVNAGKIETNIRE-KILALEAAEETSRRNSVASEIQSEA 105

Query: 914 RAVGAED 934
            A  A+D
Sbjct: 106 AASSAQD 112


>SB_8277| Best HMM Match : DUF827 (HMM E-Value=1.7)
          Length = 208

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
 Frame = +2

Query: 740 NETTRRTPKDDL--SNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSS 913
           +E      +DD+    D+E   V    ++T + +    +LEA EE SRR S  ++++  +
Sbjct: 47  DEVLELMSRDDVFTEEDVEEETVNAGKIETNIRE-KILALEAAEETSRRNSVASEIQSEA 105

Query: 914 RAVGAED 934
            A  A+D
Sbjct: 106 AASSAQD 112


>SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003)
          Length = 458

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
 Frame = +2

Query: 740 NETTRRTPKDDL--SNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSS 913
           +E      +DD+    D+E   V    ++T + +    +LEA EE SRR S  ++++  +
Sbjct: 186 DEVLELMSRDDVFTEEDVEEETVNAGKIETNIRE-KILALEAAEETSRRNSVASEIQSEA 244

Query: 914 RAVGAED 934
            A  A+D
Sbjct: 245 AASSAQD 251


>SB_44903| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1281

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 23/104 (22%), Positives = 43/104 (41%)
 Frame = +2

Query: 635  DSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRD 814
            DSN E +   +T++ +T   T+  V     QEP   ++T+     D + +  T       
Sbjct: 1168 DSNQEPVAQDSTQEPVTQDSTQEPVTQDSTQEPVTQDSTQEPVTQDSTQEPVTQDSTQEP 1227

Query: 815  VQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDHGVP 946
            V    T  P  + ++T+E   ++S      ++S   G     +P
Sbjct: 1228 VTQDSTQEP-VTQDSTQESVTQDSTQESANQNSELEGLTQDSLP 1270


>SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2193

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 14/67 (20%), Positives = 35/67 (52%)
 Frame = +2

Query: 764  KDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDHGV 943
            +DD+ +  + L  ++ + Q+R+T+L  +  +A E++  +E   +++      +   D G 
Sbjct: 1780 RDDMEHRNKQLRDDVVNFQSRITELEHKKKKADEKIEEQEDEIHELLDKLGGMSQTDGGD 1839

Query: 944  PPEVEVQ 964
              ++E Q
Sbjct: 1840 SSDLESQ 1846


>SB_7511| Best HMM Match : Peptidase_A16_N (HMM E-Value=4.4e-05)
          Length = 266

 Score = 29.9 bits (64), Expect = 3.3
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%)
 Frame = +2

Query: 740 NETTRRTPKDDL--SNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSS 913
           +E      +DD+    D+E   V    ++T + +    +LEA EE SRR S  ++++  +
Sbjct: 26  DEVLELMSRDDVFTEEDVEEETVNAGKIETNIRE-KILALEAAEETSRRNSVASEIQSEA 84

Query: 914 RAVGAED 934
            A  A+D
Sbjct: 85  AASSAQD 91


>SB_35030| Best HMM Match : Peptidase_A16_N (HMM E-Value=4.3e-05)
          Length = 353

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 2/67 (2%)
 Frame = +2

Query: 740 NETTRRTPKDDL--SNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSS 913
           +E  +   +DD+    D+E   V    ++T + +    +LEA EE +RR S  ++++  +
Sbjct: 47  DEVLKLMSRDDVFTEEDVEEETVNAGKIETTIRE-KILALEAAEETNRRNSVASEIQSEA 105

Query: 914 RAVGAED 934
            A  A+D
Sbjct: 106 AASSAQD 112


>SB_29938| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1008

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 16/54 (29%), Positives = 24/54 (44%)
 Frame = +2

Query: 5   DKKSNKIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKPDNF 166
           D +SN I  S +   +E +  I    S T+     +N VDP  NN  +   + F
Sbjct: 424 DSRSNPIPESDLHTTLEDQTLISDSPSRTIQHQNELNNVDPTVNNRHDTMSNTF 477


>SB_54714| Best HMM Match : Peptidase_A16_N (HMM E-Value=2.8e-05)
          Length = 287

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 2/67 (2%)
 Frame = +2

Query: 740 NETTRRTPKDDL--SNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSS 913
           +E  +   +DD+    D+E   V    ++T + +    +LEA EE +RR S  ++++  +
Sbjct: 47  DEVLKLMSRDDVFTEEDVEEETVNAGKIETTIRE-KILALEAAEETNRRNSVASEIQSEA 105

Query: 914 RAVGAED 934
            A  A+D
Sbjct: 106 AASSAQD 112


>SB_52621| Best HMM Match : Peptidase_A16_N (HMM E-Value=2.4e-05)
          Length = 332

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 2/67 (2%)
 Frame = +2

Query: 740 NETTRRTPKDDL--SNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSS 913
           +E      +DD+    D+E   V    ++T + +    +LEA EE SRR S  +++   +
Sbjct: 26  DEVLELMSRDDVFTEEDVEEETVNAGKIETTIRE-KILALEAAEETSRRNSVASEIESEA 84

Query: 914 RAVGAED 934
            A  A+D
Sbjct: 85  AASSAQD 91


>SB_50645| Best HMM Match : Syndecan (HMM E-Value=0.02)
          Length = 226

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 4/73 (5%)
 Frame = +2

Query: 662 SATEDILTTL-PTEPVVQTPPLQEPAINETTRRTPKDDLSND--IETLLVEIRDVQ-TRL 829
           S  E + TT+ PTE V  T  L +     T +  PKD  + +  +ET  VEI   +  + 
Sbjct: 68  SGDEAVPTTIIPTEKVTITKELTKAPEVSTRKPKPKDRKTKEPKVETEEVEITTAEPVKP 127

Query: 830 TDLPDESLEATEE 868
           T+ P E ++ T E
Sbjct: 128 TEKPTEFVKPTTE 140


>SB_42797| Best HMM Match : Peptidase_A16_N (HMM E-Value=2e-05)
          Length = 668

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 2/67 (2%)
 Frame = +2

Query: 740 NETTRRTPKDDL--SNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSS 913
           +E  +   +DD+    D+E   V    ++T + +    +LEA EE +RR S  ++++  +
Sbjct: 47  DEVLKLMSRDDVFTEEDVEEETVNAGKIETTIRE-KILALEAAEETNRRNSVASEIQSEA 105

Query: 914 RAVGAED 934
            A  A+D
Sbjct: 106 AASSAQD 112


>SB_4582| Best HMM Match : Sas10_Utp3 (HMM E-Value=0.7)
          Length = 420

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 2/67 (2%)
 Frame = +2

Query: 740 NETTRRTPKDDL--SNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSS 913
           +E      +DD+    D+E   V    ++T + +    +LEA EE SRR S  +++   +
Sbjct: 47  DEVLELMSRDDVFTEEDVEEETVNAGKIETTIRE-KILALEAAEETSRRNSVASEIESEA 105

Query: 914 RAVGAED 934
            A  A+D
Sbjct: 106 AASSAQD 112


>SB_3564| Best HMM Match : DUF1525 (HMM E-Value=8.1)
          Length = 442

 Score = 29.1 bits (62), Expect = 5.8
 Identities = 15/51 (29%), Positives = 27/51 (52%)
 Frame = +2

Query: 626 DSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLS 778
           D L +  + + ++A + +L +L T P V  PP+  PA+     R+ +  LS
Sbjct: 19  DFLANAGKTVSSAAVDVVLESLLTGPTVGLPPVNWPAVLGPLMRSSESGLS 69


>SB_50916| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1681

 Score = 28.7 bits (61), Expect = 7.6
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
 Frame = +2

Query: 764 KDDL--SNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAED 934
           +DD+    D+E   V    ++T + +    +LEA EE SRR S  +++   + A  A+D
Sbjct: 3   RDDVFTEEDVEEETVNAGKIETTIRE-KILALEAAEETSRRNSVASEIESEAAASSAQD 60


>SB_39159| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 728

 Score = 28.7 bits (61), Expect = 7.6
 Identities = 14/47 (29%), Positives = 20/47 (42%)
 Frame = -2

Query: 393 ERKYWHSASWYKCFSTQNLLSLRMFSMSTFTSVFKLRSIGFSFGWFC 253
           + K  H     KCFS+ + L L + S+     +FK       F W C
Sbjct: 572 KEKPHHCEKCGKCFSSTSYLKLHIKSVHNEKKLFKCDQCNLLFSWQC 618


>SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 6863

 Score = 28.7 bits (61), Expect = 7.6
 Identities = 17/49 (34%), Positives = 27/49 (55%)
 Frame = +2

Query: 737  INETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRE 883
            +NE  R T K+ L+   +TLL     V++ L  L D+SL  ++ V + E
Sbjct: 5080 MNEVARITEKETLTRHDDTLL---SSVESNLDGLEDKSLRVSQLVEKME 5125


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,821,160
Number of Sequences: 59808
Number of extensions: 500801
Number of successful extensions: 2072
Number of sequences better than 10.0: 31
Number of HSP's better than 10.0 without gapping: 1715
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2043
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2919714245
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).