SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0015
         (721 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_40684| Best HMM Match : NIF (HMM E-Value=0)                         96   2e-20
SB_39225| Best HMM Match : NIF (HMM E-Value=0)                         46   4e-05
SB_2044| Best HMM Match : NIF (HMM E-Value=0.0017)                     44   2e-04
SB_3920| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.002
SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16)                   33   0.18 
SB_15653| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.8  
SB_20795| Best HMM Match : Amelogenin (HMM E-Value=1)                  29   5.0  
SB_9412| Best HMM Match : Peptidase_M1 (HMM E-Value=3.1e-07)           28   6.6  
SB_46548| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.8  
SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.8  
SB_34190| Best HMM Match : MAM (HMM E-Value=0)                         28   8.8  

>SB_40684| Best HMM Match : NIF (HMM E-Value=0)
          Length = 402

 Score = 96.3 bits (229), Expect = 2e-20
 Identities = 54/124 (43%), Positives = 73/124 (58%), Gaps = 1/124 (0%)
 Frame = +2

Query: 353 NMPPDLCYRQ*DTRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKR 532
           N PP L  R   TR   +  +V+DLDETLVH S   + +A    PV      +QV+V  R
Sbjct: 202 NRPPVLPLR---TRRTPEFSLVLDLDETLVHCSLNKLEDATLSFPVSYQDITYQVFVRTR 258

Query: 533 PHVDEFLRRCGELY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKD 709
           PH+  FL R  +++  +LFTAS   YAD + ++LD     FR RLFR+ CV  +GNY+KD
Sbjct: 259 PHLKYFLERVSKVFEVILFTASKRVYADKLLNILDPEKKYFRHRLFREHCVCVQGNYIKD 318

Query: 710 LNSL 721
           L+ L
Sbjct: 319 LSIL 322


>SB_39225| Best HMM Match : NIF (HMM E-Value=0)
          Length = 1772

 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 37/113 (32%), Positives = 57/113 (50%), Gaps = 7/113 (6%)
 Frame = +2

Query: 404  KSVMVIDLDETLVHSSFK--PINNA---HFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
            K  +V+DLD+TL+H++ +  P N     HFV+P    G     +   RP   +FL++  +
Sbjct: 1078 KLALVVDLDQTLIHTTVQLVPANMKDVQHFVLP----GHPMWYHTKFRPWAHKFLQKIAK 1133

Query: 569  LY*CVLFTASLAKYADPVADLLD-RWGVFRARL-FRDSCVFHRGNYVKDLNSL 721
             Y   +FT     YA  +A +LD    +F  R+  RD C F+  +   DL SL
Sbjct: 1134 FYELHIFTMGTRMYAHTIARMLDPDLSLFGYRIRSRDDC-FNAFSKFNDLRSL 1185


>SB_2044| Best HMM Match : NIF (HMM E-Value=0.0017)
          Length = 264

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/60 (38%), Positives = 34/60 (56%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP V+ FL +   L+  V+FT  +   A PV D +D   +   RLFRD+  + +G +VK
Sbjct: 205 KRPGVEFFLNQLAPLFEIVVFTHEVGFSASPVIDGIDPHQMIMYRLFRDATKYIKGTHVK 264


>SB_3920| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 634

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 15/25 (60%), Positives = 22/25 (88%)
 Frame = +2

Query: 449 SFKPINNAHFVVPVEIDGAVHQVYV 523
           +++P++NA F+VPVEIDG VHQ+ V
Sbjct: 87  TWRPVSNADFIVPVEIDGTVHQIPV 111


>SB_24257| Best HMM Match : DUF583 (HMM E-Value=0.16)
          Length = 3999

 Score = 33.5 bits (73), Expect = 0.18
 Identities = 19/43 (44%), Positives = 22/43 (51%), Gaps = 2/43 (4%)
 Frame = +1

Query: 130  GPDRGSSPGVQHNEGDGTPVSGSTPLG--GKKSSGTGGFLRSL 252
            G   GS PG  H   DG+  +G    G  GK+ S TGGF  SL
Sbjct: 1117 GGKNGSGPGAGHTHDDGSSGAGHGGRGGRGKQQSLTGGFYGSL 1159


>SB_15653| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 364

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 11/44 (25%), Positives = 26/44 (59%)
 Frame = -2

Query: 447 LCTNVSSKSITMTLFMHVLVSHWR*QRSGGMFRHDQQGRRSPAV 316
           +C++VS  ++++ + +   +S W   R G  F ++Q  R+S ++
Sbjct: 126 ICSDVSGYTVSLAIIVTCYISIWIKMRFGKTFDNEQASRKSASL 169


>SB_20795| Best HMM Match : Amelogenin (HMM E-Value=1)
          Length = 630

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 14/60 (23%), Positives = 27/60 (45%)
 Frame = -2

Query: 363 GGMFRHDQQGRRSPAVDTIGAIASGRSLASATAPTAQQRSQEAAGPARFLPTQRGRPRNW 184
           GG   H    RR P+V  + +  +   +A+++AP    + Q     A  +   +G P+ +
Sbjct: 376 GGHHHHGNMQRRHPSVGNVSSNRNADHVANSSAPRGGSQHQNLLYNAPQIQPYQGHPQGY 435


>SB_9412| Best HMM Match : Peptidase_M1 (HMM E-Value=3.1e-07)
          Length = 1844

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = +1

Query: 142 GSSPGVQHNEGDGTPVSGSTPLGGKKSSGTG 234
           GS PG +       P +GS PLG +  +G+G
Sbjct: 474 GSKPGNRTGSSGSRPGNGSGPLGKRPGNGSG 504


>SB_46548| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1120

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 15/51 (29%), Positives = 26/51 (50%)
 Frame = +1

Query: 61  NV*MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGG 213
           N+ +  ++I  +V+ +D   NN+ PD G     +  EG G  + GS+   G
Sbjct: 245 NIKITGAAIQARVTTEDPA-NNFTPDTGRIEVFRSGEGMGIRLDGSSAFAG 294


>SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1735

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 14/47 (29%), Positives = 24/47 (51%)
 Frame = +1

Query: 94   QVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTG 234
            Q + +DE  N    ++G    +Q +E D  PV+ ++  G  K+ G G
Sbjct: 879  QDNEEDEPENKVKRNKGKPARLQDHEEDEEPVASTSATGITKTPGKG 925


>SB_34190| Best HMM Match : MAM (HMM E-Value=0)
          Length = 384

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = +1

Query: 109 DEQLNNYGPDR-GSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGGFL 243
           DE   ++  D  GSSP       +GTP SG+ P     +SG G F+
Sbjct: 174 DENWCHWSNDNTGSSPFPWKRSSEGTPTSGTGP-SKDHTSGLGSFV 218


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,609,332
Number of Sequences: 59808
Number of extensions: 523720
Number of successful extensions: 1441
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1308
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1432
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1913853903
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).