SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0013
         (823 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_28668| Best HMM Match : UCH (HMM E-Value=8e-12)                     30   2.0  
SB_47219| Best HMM Match : DUF414 (HMM E-Value=1.7)                    30   2.6  
SB_6223| Best HMM Match : Ras (HMM E-Value=0)                          29   3.4  
SB_11269| Best HMM Match : Extensin_2 (HMM E-Value=0.14)               29   6.0  
SB_2789| Best HMM Match : MAM (HMM E-Value=0.00013)                    29   6.0  

>SB_28668| Best HMM Match : UCH (HMM E-Value=8e-12)
          Length = 893

 Score = 30.3 bits (65), Expect = 2.0
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%)
 Frame = -3

Query: 821 QRRPLLLFQGWWRWRWH--SRATSADLPRITFG 729
           Q  PL+L  G+  W WH  S AT ++LP++  G
Sbjct: 191 QSEPLILDGGFDSWLWHYPSLATRSELPKVDSG 223


>SB_47219| Best HMM Match : DUF414 (HMM E-Value=1.7)
          Length = 704

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 20/67 (29%), Positives = 33/67 (49%)
 Frame = +1

Query: 370 RTYIRDSGGVMAARVSAEGAGPSYASVLNFKGGESNKENIEAHAEEALDAPPRPDIEEEE 549
           R ++  S  V A  +S   AGP   S+ +     S++ +     E+A D   +P +EE  
Sbjct: 450 RRFLASSSAVSA--LSGVSAGPDDMSIQS-----SSQVSFALDQEDAPDGQHKPPVEETL 502

Query: 550 GFVPVIS 570
           GF+P +S
Sbjct: 503 GFIPKLS 509


>SB_6223| Best HMM Match : Ras (HMM E-Value=0)
          Length = 1665

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 11/23 (47%), Positives = 13/23 (56%)
 Frame = +2

Query: 8    GSIVICRFYTCFSPQTALSIDRY 76
            G + +CRF  C SP  AL  D Y
Sbjct: 966  GPVQVCRFVNCSSPMIALQKDEY 988


>SB_11269| Best HMM Match : Extensin_2 (HMM E-Value=0.14)
          Length = 817

 Score = 28.7 bits (61), Expect = 6.0
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (3%)
 Frame = +2

Query: 539 KRRRASYRSSLMDGVLVKTGGTGNG--KHPRELIKHHNSMLTLSPQRSNSNKLQNN 700
           + +R+  +  L  GV VK   + +G  KH  E +KHH     L  Q    N L+ +
Sbjct: 20  EHKRSGLKGRLFGGVKVKRARSFSGREKHKIETLKHHKDGKRLRAQSLTFNALKTS 75


>SB_2789| Best HMM Match : MAM (HMM E-Value=0.00013)
          Length = 363

 Score = 28.7 bits (61), Expect = 6.0
 Identities = 10/20 (50%), Positives = 16/20 (80%), Gaps = 1/20 (5%)
 Frame = -1

Query: 520 ARLT-PPLRGPQCFLYYFRL 464
           AR+T PPL GPQC ++++ +
Sbjct: 5   ARITSPPLTGPQCLMFWYHM 24


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,819,228
Number of Sequences: 59808
Number of extensions: 510054
Number of successful extensions: 2286
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 2063
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2279
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2299585728
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).