SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0011
         (939 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_17025| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   2e-10
SB_23913| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.25 
SB_53028| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.58 
SB_842| Best HMM Match : No HMM Matches (HMM E-Value=.)                31   1.0  
SB_13703| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.4  
SB_56065| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   3.1  
SB_18943| Best HMM Match : DUF753 (HMM E-Value=5.9)                    30   3.1  
SB_2144| Best HMM Match : MACPF (HMM E-Value=0.007)                    30   3.1  
SB_36850| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.1  
SB_49225| Best HMM Match : Vicilin_N (HMM E-Value=9.1)                 29   5.4  
SB_26017| Best HMM Match : Extensin_2 (HMM E-Value=0.11)               29   5.4  
SB_57228| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   7.2  
SB_49671| Best HMM Match : Involucrin2 (HMM E-Value=7)                 29   7.2  
SB_47920| Best HMM Match : Kelch_1 (HMM E-Value=1.9e-34)               29   7.2  
SB_33316| Best HMM Match : DUF329 (HMM E-Value=7.6)                    29   7.2  
SB_30672| Best HMM Match : Colipase (HMM E-Value=6.5)                  29   7.2  
SB_5724| Best HMM Match : Vicilin_N (HMM E-Value=3)                    28   9.5  

>SB_17025| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 260

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 38/117 (32%), Positives = 61/117 (52%), Gaps = 5/117 (4%)
 Frame = +1

Query: 532 VMCEITFDPGKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRYNGARLCSM 711
           ++ ++T  PG+F+ L   LV ++ + +N++     +   I+ QSI E+NF Y GARLC  
Sbjct: 66  ILDQLTESPGEFENLVEDLVLAWKARVNNDETLNEIASVIMEQSILESNFTYTGARLCDF 125

Query: 712 YDSVAQ---PEESVFRECLLERCSVEENKIISGLE--TSEENMRGFAMFLAEIILSF 867
             +       E   FR   L RC  E  K  + L+  ++   + G AMFLAE+  +F
Sbjct: 126 IANNTDDIPTEGKQFRSVFLTRCKEEHRKREAMLKSPSTVPRVHGLAMFLAELYSTF 182


>SB_23913| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 905

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = +1

Query: 319 DAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLD 462
           D K W+P +  +   P   TEP+ ++P R    G+   AQ  NP N D
Sbjct: 606 DNKAWHPYHGHTVRAPV-ETEPSYHQPPRGQTNGQATNAQRANPINGD 652


>SB_53028| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 259

 Score = 32.3 bits (70), Expect = 0.58
 Identities = 14/29 (48%), Positives = 20/29 (68%)
 Frame = -2

Query: 839 IANPRIFSSEVSKPLIILFSSTEQRSSRH 753
           + N +I+SSE++ P  +  SSTEQ SS H
Sbjct: 60  VPNSKIYSSELAPPTSVKLSSTEQLSSLH 88


>SB_842| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 397

 Score = 31.5 bits (68), Expect = 1.0
 Identities = 26/104 (25%), Positives = 45/104 (43%)
 Frame = +1

Query: 187 NGDISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALP 366
           NG ++  +   RG + NN+    RRP+ +++E +V   +  L    ++      TS    
Sbjct: 282 NGVLNVVRRPRRGEEQNNEEERSRRPRVLTEEQRVRQRQRDLVLTEEQRVLKRQTSY--- 338

Query: 367 AYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENM 498
                   YR S   +   +R  Q  + Y LDD   + +EAE +
Sbjct: 339 -------EYRLSGEQI---VRNKQKDSEYELDDEQRARKEAEKL 372


>SB_13703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1358

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 25/120 (20%), Positives = 50/120 (41%)
 Frame = +1

Query: 379 EPAPYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENMDLRENIANLITVMCEITFDP 558
           E  P+R  R  ++ RL  A+DQ      +   ++++       E +   +    E+    
Sbjct: 76  EIQPFREMRLEIKKRLENARDQEKEEEMEKELAMKKKVERRFIEQMYGTVDKQVELY--- 132

Query: 559 GKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRYNGARLCSMYDSVAQPEE 738
            K   L   ++DSF   L+  +  +P++  + N  I E   +YN  R  +  D  +  ++
Sbjct: 133 -KIQ-LGSTVLDSFRMELHCINAEKPIITHLPNPRIPELKKKYNKLRRLTFSDETSTEDK 190


>SB_56065| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 455

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = -2

Query: 824 IFSSEVSKPLIILFSSTEQRSSRHSRNTDSSGCATESYIEHKRAPLYRKFASPID*LTM 648
           +F S+  K   +L   TE+R    +R  + S   TES + H   PL R     +D LT+
Sbjct: 349 VFESDPQKKRPLLPRRTEERVGTDARARNGSSLGTES-VTHSDKPLLRDPLDEMDELTL 406


>SB_18943| Best HMM Match : DUF753 (HMM E-Value=5.9)
          Length = 676

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 3/65 (4%)
 Frame = +2

Query: 551 LTRASLTPCV-VPWW--IHLLQHLMMKAIPDPWWMPLLISQSAKQISGTMELVCVQCTIQ 721
           +++AS  P   +PW+  + LL H  +  +   W M    +++   I+  +E+    C I 
Sbjct: 125 ISKASADPSKPLPWFDKVRLLMHGRLHLVVKEWLMYFSATRNPYDITERLEVDWTNCDIL 184

Query: 722 WRNLR 736
           W N R
Sbjct: 185 WTNGR 189


>SB_2144| Best HMM Match : MACPF (HMM E-Value=0.007)
          Length = 434

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 10/46 (21%), Positives = 20/46 (43%)
 Frame = -3

Query: 508 PVDPCFQLLQVNKTCHPNCMDFDLELDEVYLVQRGEMVYMGQVQCC 371
           P DPC+   +  K C      +D+++  +Y+      + +G    C
Sbjct: 137 PGDPCYTAKETTKQCRQYLSVYDIDVSRIYVNYHNHFIMLGFCYRC 182


>SB_36850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1008

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 20/67 (29%), Positives = 27/67 (40%), Gaps = 3/67 (4%)
 Frame = +1

Query: 229 QMNNQARELRRPKAVSDEPKVDTSKSKLSADAK---EWYPANYTSQALPAYNTEPAPYRP 399
           Q  N    LR+PK +     V ++KS L           P +  S + P     P P RP
Sbjct: 169 QPTNPIPSLRQPKNIPLSTSVTSAKSSLDHCTSFQINMLPEHACSSSHPLTRPIPKPQRP 228

Query: 400 SRPSVQG 420
            +PS  G
Sbjct: 229 PQPSKSG 235


>SB_49225| Best HMM Match : Vicilin_N (HMM E-Value=9.1)
          Length = 121

 Score = 29.1 bits (62), Expect = 5.4
 Identities = 24/93 (25%), Positives = 40/93 (43%)
 Frame = +1

Query: 220 RGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALPAYNTEPAPYRP 399
           RG + NN+    RRP+ +++E +V   +  L    ++      TS            YR 
Sbjct: 17  RGEEQNNEEERSRRPRVLTEEQRVRQRQRDLVLTEEQRVLKRQTSY----------EYRL 66

Query: 400 SRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENM 498
           S   +   +R  Q  + Y LDD   + +EAE +
Sbjct: 67  SGEQI---VRNKQKDSEYELDDEQRARKEAEKL 96


>SB_26017| Best HMM Match : Extensin_2 (HMM E-Value=0.11)
          Length = 1704

 Score = 29.1 bits (62), Expect = 5.4
 Identities = 33/148 (22%), Positives = 54/148 (36%), Gaps = 2/148 (1%)
 Frame = +1

Query: 283  PKVDTSKSKLSADAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLD 462
            P   +  S LS   +E     +  +     + EP P  PS  S + +   A+D  P  +D
Sbjct: 973  PPCVSQSSSLSVPVQEPIVDGHDVEVSSLLSKEPLPQSPSISSSEHKCGVAEDAAPTLVD 1032

Query: 463  DMSYSLEEAENMDLRENI--ANLITVMCEITFDPGKFDTLCGPLVDSFASTLNDESYTRP 636
                S      M    +    +      +  F P K  +   P  DS +++  ++S   P
Sbjct: 1033 SNPCSSRSPIRMPASPSSRGGSAPLPSFDAMFSPTKQKSF-PPAPDSNSTSPKEKSKRSP 1091

Query: 637  LVDAIVNQSIGEANFRYNGARLCSMYDS 720
            +  A   +    AN +    RL   YDS
Sbjct: 1092 VTKASKPRGKKVANKKQGALRLLMQYDS 1119


>SB_57228| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1056

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 25/106 (23%), Positives = 46/106 (43%)
 Frame = +1

Query: 181 MNNGDISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQA 360
           ++ GD    +   RG + NN+    RRP+ +++E +    +  L    K+      TS  
Sbjct: 4   ISRGDKRVKEDPRRGEEHNNEEERSRRPRVLTEEQRARQRQRDLVLTEKQKVRKRQTS-- 61

Query: 361 LPAYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENM 498
                   + YR S    + R+R+ Q  + Y L+D   + +EA  +
Sbjct: 62  --------SEYRLSG---EQRVRKKQKDSEYELNDEQRARKEAAKL 96


>SB_49671| Best HMM Match : Involucrin2 (HMM E-Value=7)
          Length = 145

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 24/107 (22%), Positives = 46/107 (42%)
 Frame = +1

Query: 181 MNNGDISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQA 360
           ++ GD    +   RG + NN+    RRP+ +++E +    +  L    ++      TS  
Sbjct: 4   LSRGDKRVEEEPRRGEERNNEKERSRRPRVLTEEQRARQRQRDLVLTEEQRVRKRQTS-- 61

Query: 361 LPAYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENMD 501
                   + YR S    + R+R+ Q  + Y LDD   + +   N++
Sbjct: 62  --------SEYRLSG---KQRVRKKQKDSEYELDDEQRARKRQRNLE 97


>SB_47920| Best HMM Match : Kelch_1 (HMM E-Value=1.9e-34)
          Length = 405

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 2/55 (3%)
 Frame = +1

Query: 304 SKLSADAKEWYPANYTSQALP--AYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLD 462
           SK S   KEW   +  ++++P   Y  E   Y+ S   + G +     Q  YNLD
Sbjct: 197 SKFSFKTKEWKYVSTQNESVPFPRYRHEAVDYKGSFYVIGGGMGSTDPQEFYNLD 251


>SB_33316| Best HMM Match : DUF329 (HMM E-Value=7.6)
          Length = 102

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 24/107 (22%), Positives = 45/107 (42%)
 Frame = +1

Query: 181 MNNGDISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQA 360
           ++ GD    +   RG + NN+    RRP+ +++E +       L    ++      TS  
Sbjct: 4   LSRGDKRVEEEPRRGEERNNEEERSRRPRVLTEEQRARKRARDLVLTEEQRVRKRQTS-- 61

Query: 361 LPAYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENMD 501
                   + YR S    + R+R+ Q  + Y LDD   + +   N++
Sbjct: 62  --------SEYRLSG---EQRVRKGQKDSEYELDDEQRARKRQRNLE 97


>SB_30672| Best HMM Match : Colipase (HMM E-Value=6.5)
          Length = 305

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = +2

Query: 608 HLMMKAIPDPWWMPLLISQSAKQISGTMELVCVQCT-IQWRNLRSLYSASAC 760
           H+M +   + WW P + S++    +G +E+ C Q T I   +  ++Y ++ C
Sbjct: 90  HIMRR---ESWWHPCVKSKAVNPGTGELEVTCYQTTSIGCYHNLAIYGSTRC 138


>SB_5724| Best HMM Match : Vicilin_N (HMM E-Value=3)
          Length = 861

 Score = 28.3 bits (60), Expect = 9.5
 Identities = 25/107 (23%), Positives = 47/107 (43%)
 Frame = +1

Query: 181 MNNGDISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQA 360
           ++ GD    + R RG + NN+    RRP+ +++E +    +  L    ++      TS  
Sbjct: 4   LSRGDKRVEEPR-RGEEQNNEDERSRRPRVLTEEQRARQRQRDLVLTEEQRVRKRQTS-- 60

Query: 361 LPAYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENMD 501
                   + YR S    + R+R+ Q  + Y LDD   + +   N++
Sbjct: 61  --------SEYRLSG---KQRVRKGQKDSEYELDDEQRARKRQRNLE 96


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 30,559,571
Number of Sequences: 59808
Number of extensions: 697038
Number of successful extensions: 1793
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1648
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1785
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2740956230
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).