SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0009
         (585 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_58050| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.69 
SB_7302| Best HMM Match : DUF910 (HMM E-Value=2.2)                     30   1.6  
SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)                 29   2.8  
SB_40142| Best HMM Match : DUF827 (HMM E-Value=1.2)                    29   2.8  
SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076)         29   2.8  
SB_6444| Best HMM Match : CRAM_rpt (HMM E-Value=3e-11)                 29   2.8  
SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19)                   28   4.9  
SB_32677| Best HMM Match : SapB_1 (HMM E-Value=4.1)                    28   4.9  
SB_10217| Best HMM Match : ubiquitin (HMM E-Value=1.6e-06)             28   4.9  
SB_10041| Best HMM Match : ig (HMM E-Value=3.5e-06)                    28   6.4  
SB_3069| Best HMM Match : zf-C2H2 (HMM E-Value=1e-06)                  28   6.4  
SB_56923| Best HMM Match : PT (HMM E-Value=0.95)                       28   6.4  
SB_15832| Best HMM Match : zf-C2H2 (HMM E-Value=7e-35)                 28   6.4  
SB_29149| Best HMM Match : Usp (HMM E-Value=0.0028)                    27   8.5  
SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20)                  27   8.5  
SB_3971| Best HMM Match : UPF0058 (HMM E-Value=5.6)                    27   8.5  

>SB_58050| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 307

 Score = 31.1 bits (67), Expect = 0.69
 Identities = 19/45 (42%), Positives = 19/45 (42%)
 Frame = +1

Query: 271 GATVPLNY*GTVRPGYPPSPYPGHTGNGAHPGCDLAPTTEGRLGA 405
           GA  P    G V    PP P PGH G    PG   AP   G  GA
Sbjct: 88  GAPGPPGEPGQVGMAGPPGP-PGHVGEDGAPGAPGAPGPPGSPGA 131


>SB_7302| Best HMM Match : DUF910 (HMM E-Value=2.2)
          Length = 288

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 18/36 (50%), Positives = 21/36 (58%)
 Frame = +3

Query: 414 DA*STFPQFRTPTPLRGSTTRQSALSTPSGERSTRR 521
           D  S F + RTP PLR S TRQS   TPS    T++
Sbjct: 125 DLESFFTKHRTPIPLRLSGTRQS--GTPSDLERTKK 158


>SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)
          Length = 406

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = +2

Query: 215 HIPTAAQLQPDVLDVCVH 268
           HIP+ AQLQ D+ D C+H
Sbjct: 230 HIPSPAQLQDDLRDDCMH 247


>SB_40142| Best HMM Match : DUF827 (HMM E-Value=1.2)
          Length = 334

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 3/58 (5%)
 Frame = -2

Query: 197 RPQSSRPYRHLLTAACPLLSSVGSPTRRASR*GPRP---AELGGCRNSGPVLCPRGEN 33
           R ++    R  LT A P   S  SPT    R  P+P   ++    + + P + PRG+N
Sbjct: 177 RDRAKEKERIPLTPATPSTPSTPSPTSETPRPRPQPPKRSDSFNIKRNRPFIIPRGDN 234


>SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076)
          Length = 888

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 1/30 (3%)
 Frame = +2

Query: 44  GDIRRVLNCDSRPAL-LVGDLNAKHVAWGS 130
           G +R++   D+ PA+ L+GD N +HV W S
Sbjct: 370 GGVRKLHPSDNPPAIYLLGDFNFRHVDWVS 399


>SB_6444| Best HMM Match : CRAM_rpt (HMM E-Value=3e-11)
          Length = 2297

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 19/60 (31%), Positives = 29/60 (48%)
 Frame = +3

Query: 384  DRRSTGSSLRDA*STFPQFRTPTPLRGSTTRQSALSTPSGERSTRRRLLCPAAGPEVYSR 563
            DR S+ SS  D     P+ +    L     R+S+ S+  GE+  RRR    ++G E  S+
Sbjct: 1291 DRSSSSSSSSDDEIKAPRIKGGLELAKQRHRKSSSSSSDGEKQRRRRRRKSSSGSEGKSK 1350


>SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19)
          Length = 619

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%)
 Frame = +1

Query: 4   YSAYMTPGA*FSPRGHKTGPELRQPP-SSAGRGPQREARRVGLPT 135
           Y A   P     PRG  TGP  R PP SSA     + + R G P+
Sbjct: 293 YGAIPPPVYQTIPRGPATGPATRWPPSSSASSHMSQHSFREGAPS 337


>SB_32677| Best HMM Match : SapB_1 (HMM E-Value=4.1)
          Length = 256

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 5/53 (9%)
 Frame = +2

Query: 176 RGDYSVVGPDEPTHIPTAAQ-----LQPDVLDVCVHKGLRCPLTIEALYDLGT 319
           R  Y     D+ T + T        LQ  ++D+C++ GL+    +EA +  GT
Sbjct: 39  RSKYHTREKDQQTQLKTQIDTFILILQVRIIDICINSGLKAQENLEAQFGPGT 91


>SB_10217| Best HMM Match : ubiquitin (HMM E-Value=1.6e-06)
          Length = 479

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 23/86 (26%), Positives = 33/86 (38%), Gaps = 2/86 (2%)
 Frame = +2

Query: 209 PTHIPTAAQLQPDVLDVCVHKGLRCPLTIEALYDLGTPHLPILV-TLGMGLT-RVATSPL 382
           PT +P +    P   D   H+G          Y LG P +  +     +GLT     SP 
Sbjct: 115 PTRVPDSTSPTPAQADGLRHRGTPMQTPSPFNYPLGLPQMHFMQHPQHVGLTFATPPSPT 174

Query: 383 RPKVDWELFKRRLVDLPAIQDPNTPE 460
            P VD +L +++    P   D    E
Sbjct: 175 TPPVDQQLPQQQAPPPPPPADQGNEE 200


>SB_10041| Best HMM Match : ig (HMM E-Value=3.5e-06)
          Length = 333

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%)
 Frame = +2

Query: 356 LTRVATSPLRPKVDWELFKRRLVDLPAIQD-PNTP 457
           +TR + SPL P   W+L  +    LP I D P +P
Sbjct: 97  MTRTSPSPLSPSASWDLKVKEESLLPKIADFPYSP 131


>SB_3069| Best HMM Match : zf-C2H2 (HMM E-Value=1e-06)
          Length = 625

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 15/43 (34%), Positives = 24/43 (55%)
 Frame = -1

Query: 207 SSGPTTE*SPLSASSNSRLPTAEFSREPHATCFALRSPTSRAG 79
           SSGP+T+ +P S  S + + T  F+  P +    ++SP S  G
Sbjct: 51  SSGPSTDSAPPSNQSKTTVNTNSFAHSPSSD---IKSPASTMG 90


>SB_56923| Best HMM Match : PT (HMM E-Value=0.95)
          Length = 441

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 21/62 (33%), Positives = 28/62 (45%)
 Frame = -1

Query: 204 SGPTTE*SPLSASSNSRLPTAEFSREPHATCFALRSPTSRAGRLSQFRTRLMSPG*KSGP 25
           S PT   S +++   S++     S  PH  C    SPTS AG  S F + + S G    P
Sbjct: 307 STPTESTSSMTSPCGSQMSYPARS-PPHVQCDPF-SPTSSAGHPSPFPSPIGSHGPSISP 364

Query: 24  GG 19
            G
Sbjct: 365 AG 366


>SB_15832| Best HMM Match : zf-C2H2 (HMM E-Value=7e-35)
          Length = 337

 Score = 27.9 bits (59), Expect = 6.4
 Identities = 15/43 (34%), Positives = 24/43 (55%)
 Frame = -1

Query: 207 SSGPTTE*SPLSASSNSRLPTAEFSREPHATCFALRSPTSRAG 79
           SSGP+T+ +P S  S + + T  F+  P +    ++SP S  G
Sbjct: 194 SSGPSTDSAPPSNQSKTTVNTNSFAHSPSSD---IKSPASTMG 233


>SB_29149| Best HMM Match : Usp (HMM E-Value=0.0028)
          Length = 106

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 21/52 (40%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = +2

Query: 89  LVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDEP-THIPTAAQLQ 241
           L  DL+AKHV  GSR    + R LL      DY V     P T IP   + Q
Sbjct: 55  LAKDLSAKHVVMGSRGCGTIRRTLLGSV--SDYCVHHSSVPVTVIPPTKKRQ 104


>SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20)
          Length = 1313

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 21/63 (33%), Positives = 28/63 (44%)
 Frame = +3

Query: 360  PGLRPRPYDRRSTGSSLRDA*STFPQFRTPTPLRGSTTRQSALSTPSGERSTRRRLLCPA 539
            P  +PRP  RRS   S+          ++P+P R      S+ S+ S  RS RRR   P 
Sbjct: 1104 PPTKPRP-SRRSLSKSVS---------KSPSPARKGKRSSSSSSSRSRSRSPRRRKRSPT 1153

Query: 540  AGP 548
              P
Sbjct: 1154 PKP 1156


>SB_3971| Best HMM Match : UPF0058 (HMM E-Value=5.6)
          Length = 132

 Score = 27.5 bits (58), Expect = 8.5
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = -2

Query: 230 RRSECAWVRRGRPQSSRPYRHLL 162
           RRS+  W++   P++S  Y H+L
Sbjct: 90  RRSQSKWIKENVPETSEVYDHIL 112


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,450,488
Number of Sequences: 59808
Number of extensions: 505935
Number of successful extensions: 2058
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 1902
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2052
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1410146228
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).