SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0004
         (717 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)             290   7e-79
SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)             290   7e-79
SB_56| Best HMM Match : Actin (HMM E-Value=0)                         290   7e-79
SB_56628| Best HMM Match : Actin (HMM E-Value=0)                      290   9e-79
SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)              288   3e-78
SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)              288   3e-78
SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07)                258   2e-69
SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)              99   2e-21
SB_54| Best HMM Match : Actin (HMM E-Value=0)                          86   3e-17
SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10)                 85   4e-17
SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)                  69   4e-12
SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   4e-07
SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)             38   0.006
SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)                 36   0.043
SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.53 
SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0)                30   2.2  
SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0)                      29   2.8  
SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0)                29   5.0  
SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19)                   29   5.0  
SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.6  
SB_8479| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   6.6  

>SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 338

 Score =  290 bits (712), Expect = 7e-79
 Identities = 134/140 (95%), Positives = 138/140 (98%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA
Sbjct: 199 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 258

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 259 NTVLSGGTTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 318

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP+IVHRKCF
Sbjct: 319 WISKQEYDESGPAIVHRKCF 338


>SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 376

 Score =  290 bits (712), Expect = 7e-79
 Identities = 134/140 (95%), Positives = 138/140 (98%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>SB_56| Best HMM Match : Actin (HMM E-Value=0)
          Length = 375

 Score =  290 bits (712), Expect = 7e-79
 Identities = 134/140 (95%), Positives = 138/140 (98%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>SB_56628| Best HMM Match : Actin (HMM E-Value=0)
          Length = 376

 Score =  290 bits (711), Expect = 9e-79
 Identities = 134/140 (95%), Positives = 138/140 (98%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 375

 Score =  288 bits (707), Expect = 3e-78
 Identities = 133/140 (95%), Positives = 138/140 (98%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA
Sbjct: 236 LEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYA 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGG+TM+PGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 356 WISKQEYDESGPSIVHRKCF 375


>SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 349

 Score =  288 bits (706), Expect = 3e-78
 Identities = 132/140 (94%), Positives = 138/140 (98%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EKSYELPDGQVITIGNERFRCPEAL QPSFLGME+ GIHETTYNSIMKCDVDIRKDLYA
Sbjct: 210 IEKSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYA 269

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTV+SGGTTMYPG+ADRMQKEI+ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 270 NTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 329

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP+IVHRKCF
Sbjct: 330 WISKQEYDESGPAIVHRKCF 349


>SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07)
          Length = 149

 Score =  258 bits (633), Expect = 2e-69
 Identities = 117/142 (82%), Positives = 130/142 (91%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDL 533
           P LEK+YELPDGQVI+IGNERFRCPEA+FQP+FLGMEA GIHE  YN IMKCDVDIRKDL
Sbjct: 8   PILEKTYELPDGQVISIGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIRKDL 67

Query: 532 YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQ 353
           Y+N VLSGG+TM+PGIADRMQKEI  LA ++MK+K+IAPPERKYSVWIGGSILASLSTFQ
Sbjct: 68  YSNCVLSGGSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLSTFQ 127

Query: 352 QMWISKQEYDESGPSIVHRKCF 287
           QMWI+K+EY E GP IVHRKCF
Sbjct: 128 QMWIAKEEYHEYGPPIVHRKCF 149


>SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 411

 Score =   99 bits (238), Expect = 2e-21
 Identities = 59/160 (36%), Positives = 87/160 (54%), Gaps = 29/160 (18%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L + Y LPDG+V+ +  ERF  PEALFQP  + +E  G+ E  +N+I   D+D R + Y 
Sbjct: 240 LVEQYTLPDGRVVKLSGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYK 299

Query: 526 NTVLSGGTTMYPGIADRMQKEITAL---------------------APST-----MKIKI 425
           + VLSGG+TMYPG+  R+++EI  L                      P T      K KI
Sbjct: 300 HIVLSGGSTMYPGLPSRLEREIKQLYLERVLKGDTSKLSSGMGMEQIPLTADYLLQKFKI 359

Query: 424 -IAPP-ERKYSVWIGGSILAS-LSTFQQMWISKQEYDESG 314
            I  P  RK+ V++GG++LA  +      W++++EY+E G
Sbjct: 360 RIEDPPRRKHMVFMGGAVLADIMKDKDSFWMTRKEYEEKG 399


>SB_54| Best HMM Match : Actin (HMM E-Value=0)
          Length = 2486

 Score = 85.8 bits (203), Expect = 3e-17
 Identities = 39/65 (60%), Positives = 47/65 (72%)
 Frame = -3

Query: 703  EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
            E  Y LPDGQ I IG+ERFR  E LFQPS LG +  GIHE+ + SI KCD+D+R +L+ N
Sbjct: 2282 EAPYMLPDGQSIRIGSERFRAAEPLFQPSLLGRDIDGIHESIFKSIKKCDIDLRAELFHN 2341

Query: 523  TVLSG 509
             VLSG
Sbjct: 2342 IVLSG 2346


>SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10)
          Length = 543

 Score = 85.4 bits (202), Expect = 4e-17
 Identities = 50/149 (33%), Positives = 75/149 (50%), Gaps = 17/149 (11%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           + +  ERF  PE  F P F   +    + E   N I  C +D+R+ LY N VLSGG+TM+
Sbjct: 196 VDVAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLSGGSTMF 255

Query: 493 PGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLS 362
                R+Q++I                  + P  ++ ++I+   ++Y+VW GGS+LAS  
Sbjct: 256 RDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQVISHHMQRYAVWFGGSMLASTP 315

Query: 361 TFQQMWISKQEYDESGPSIVHRKCF*THR 275
            F  +  +K +YDE GPSI     F  HR
Sbjct: 316 EFYSVCHTKADYDEHGPSICRHNPF-LHR 343


>SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)
          Length = 240

 Score = 68.9 bits (161), Expect = 4e-12
 Identities = 30/85 (35%), Positives = 54/85 (63%), Gaps = 3/85 (3%)
 Frame = -3

Query: 610 GMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKI 431
           G  A G+ +    S+   D+DIR  L+ + +++GG T+  G  +R+ +E+ +  P +M++
Sbjct: 146 GSTAMGVTQVVTTSVGMTDIDIRAGLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRL 205

Query: 430 KII---APPERKYSVWIGGSILASL 365
           K+I   +  E++++ WIGGSILASL
Sbjct: 206 KLISNNSSVEKRFNPWIGGSILASL 230


>SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 245

 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 9/94 (9%)
 Frame = -3

Query: 574 NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPS--------TMKIKIIA 419
           +S++ C +D RK L  N VL GGT M PG   R+ +EI  L  S           +K+  
Sbjct: 64  DSLLLCPIDTRKTLAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQ 123

Query: 418 PP-ERKYSVWIGGSILASLSTFQQMWISKQEYDE 320
           PP     + W+GG+I  SL        +++ Y +
Sbjct: 124 PPVNANITAWLGGAIFGSLEVLADRSTTRERYQQ 157


>SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)
          Length = 367

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 15/28 (53%), Positives = 23/28 (82%)
 Frame = -3

Query: 571 SIMKCDVDIRKDLYANTVLSGGTTMYPG 488
           +I K D+D+R+ LY+N VLSGG+T++ G
Sbjct: 264 AIQKSDLDLRRVLYSNIVLSGGSTLFKG 291


>SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)
          Length = 921

 Score = 35.5 bits (78), Expect = 0.043
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFL 611
           L K Y LPDGQ+I+IG E     E LF+P  L
Sbjct: 867 LTKFYTLPDGQMISIGYECISSMEPLFRPDLL 898


>SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 40

 Score = 31.9 bits (69), Expect = 0.53
 Identities = 13/20 (65%), Positives = 15/20 (75%)
 Frame = -3

Query: 640 PEALFQPSFLGMEACGIHET 581
           PE +FQPS LG+E  GI ET
Sbjct: 3   PEIIFQPSMLGLEQAGITET 22


>SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0)
          Length = 1973

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +3

Query: 378 IDPPIHTEYFLSGGAMILIFIVDGARAVISFCIRSAIPGYMV-VPPD-NTVLAYKSLRMS 551
           +DPP+  +Y L+GG  ++   +        FCI     G++V  PP+ N+ +     R++
Sbjct: 758 LDPPLENKYNLNGGQQVIQSTLQIQSLFFPFCI---FQGFVVPTPPECNSAIVLPDARIT 814

Query: 552 TS 557
            S
Sbjct: 815 AS 816


>SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0)
          Length = 1066

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 2/42 (4%)
 Frame = -1

Query: 360  PSNRCGSRNRSTTSLAPPLYTGSASK--RTARRCLQQPAAGC 241
            P N+ G++ R   +L  P++TGS  +  RT +     P+A C
Sbjct: 879  PGNQAGNKTRPLRALRSPIHTGSTLEVDRTRQGTRPDPSARC 920


>SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0)
          Length = 603

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%)
 Frame = -2

Query: 704 REVLRTSRRSGHHYRKRKIPLPR--GSLPTLVLGYGSLRHPR 585
           R++LR  R   HHYR+    + R  G++P   + Y + R PR
Sbjct: 521 RDLLRALRNKKHHYRELPDEVKRSLGTIPDEYVRYFTSRFPR 562


>SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19)
          Length = 158

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = -1

Query: 672 SSLSETKDSVAQRLSSNPRSWVWK 601
           S+ SETK SV +R +   + W+W+
Sbjct: 96  STKSETKASVVERFNRTSKEWMWR 119


>SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 205

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 10/27 (37%), Positives = 17/27 (62%)
 Frame = -3

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAP 446
           N  ++GG TMY     R+++E+ A+ P
Sbjct: 132 NVFVTGGNTMYNNFMARLERELLAIRP 158


>SB_8479| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 548

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = -1

Query: 393 GSVDRSSPPSLPSNRCGSRNRS----TTSLAPPLYTGSASKRTARRC 265
           GS+   SP S P +R GSR R+    T+S A    +     +T ++C
Sbjct: 338 GSIAPPSPTSTPRSRTGSRTRTPPTPTSSRASSRGSARGGAKTTKKC 384


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,795,442
Number of Sequences: 59808
Number of extensions: 518812
Number of successful extensions: 1451
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 1344
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1447
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1901817086
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).