SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0002
         (698 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   6e-08
SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.)              55   6e-08
SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.)              53   3e-07
SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.)               48   7e-06
SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.)               39   0.004
SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.)               39   0.004
SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.004
SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.008
SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.)              36   0.024
SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.055
SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.7  
SB_595| Best HMM Match : CH (HMM E-Value=0)                            29   3.6  
SB_13633| Best HMM Match : Glyco_hydro_31 (HMM E-Value=0)              29   4.8  
SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5)            29   4.8  
SB_35396| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.3  
SB_24390| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.3  
SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.)                28   8.4  
SB_1307| Best HMM Match : Filament (HMM E-Value=0.13)                  28   8.4  

>SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 61.7 bits (143), Expect = 6e-10
 Identities = 30/37 (81%), Positives = 31/37 (83%)
 Frame = -3

Query: 111 SWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVL 1
           SWI  RRT+AKAFAK VFINQERKLE RRR DT LVL
Sbjct: 4   SWIYERRTTAKAFAKNVFINQERKLEDRRRSDTVLVL 40


>SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 27/32 (84%), Positives = 28/32 (87%)
 Frame = -3

Query: 96  RRTSAKAFAKGVFINQERKLEVRRRLDTALVL 1
           RRT+AKAFAK VFINQERKLE RRR DT LVL
Sbjct: 9   RRTTAKAFAKNVFINQERKLEDRRRSDTVLVL 40


>SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 27/32 (84%), Positives = 28/32 (87%)
 Frame = -3

Query: 96  RRTSAKAFAKGVFINQERKLEVRRRLDTALVL 1
           RRT+AKAFAK VFINQERKLE RRR DT LVL
Sbjct: 9   RRTTAKAFAKNVFINQERKLEDRRRSDTVLVL 40


>SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 27/32 (84%), Positives = 28/32 (87%)
 Frame = -3

Query: 96  RRTSAKAFAKGVFINQERKLEVRRRLDTALVL 1
           RRT+AKAFAK VFINQERKLE RRR DT LVL
Sbjct: 9   RRTTAKAFAKNVFINQERKLEDRRRSDTVLVL 40


>SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 48

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 27/32 (84%), Positives = 28/32 (87%)
 Frame = -3

Query: 96  RRTSAKAFAKGVFINQERKLEVRRRLDTALVL 1
           RRT+AKAFAK VFINQERKLE RRR DT LVL
Sbjct: 11  RRTTAKAFAKNVFINQERKLEDRRRSDTVLVL 42


>SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 65

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 26/31 (83%), Positives = 27/31 (87%)
 Frame = -3

Query: 93  RTSAKAFAKGVFINQERKLEVRRRLDTALVL 1
           RT+AKAFAK VFINQERKLE RRR DT LVL
Sbjct: 29  RTTAKAFAKNVFINQERKLEDRRRSDTVLVL 59


>SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 99

 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 23/27 (85%), Positives = 24/27 (88%)
 Frame = -3

Query: 93 RTSAKAFAKGVFINQERKLEVRRRLDT 13
          RT+AKAFAK VFINQERKLE RRR DT
Sbjct: 2  RTTAKAFAKNVFINQERKLEDRRRSDT 28


>SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 22/33 (66%), Positives = 26/33 (78%), Gaps = 1/33 (3%)
 Frame = -3

Query: 96  RRTS-AKAFAKGVFINQERKLEVRRRLDTALVL 1
           R+T+  ++ AK VFINQERKLE RRR DT LVL
Sbjct: 8   RKTNYCESIAKNVFINQERKLEDRRRSDTVLVL 40



 Score = 29.5 bits (63), Expect = 2.7
 Identities = 14/27 (51%), Positives = 16/27 (59%)
 Frame = -2

Query: 118 VKFLDRRKTNISESICQRCFHQSRTKV 38
           VKFLD RKTN  ESI +  F     K+
Sbjct: 2   VKFLDLRKTNYCESIAKNVFINQERKL 28


>SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 20/33 (60%), Positives = 25/33 (75%), Gaps = 1/33 (3%)
 Frame = -3

Query: 96  RRTS-AKAFAKGVFINQERKLEVRRRLDTALVL 1
           R+T+  ++  + VFINQERKLE RRR DT LVL
Sbjct: 8   RKTNYCESICQDVFINQERKLEDRRRSDTVLVL 40



 Score = 33.9 bits (74), Expect = 0.13
 Identities = 16/27 (59%), Positives = 17/27 (62%)
 Frame = -2

Query: 118 VKFLDRRKTNISESICQRCFHQSRTKV 38
           VKFLD RKTN  ESICQ  F     K+
Sbjct: 2   VKFLDLRKTNYCESICQDVFINQERKL 28


>SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 17/27 (62%), Positives = 18/27 (66%)
 Frame = -2

Query: 118 VKFLDRRKTNISESICQRCFHQSRTKV 38
           VKFLD RKTN  ESICQ CF     K+
Sbjct: 2   VKFLDLRKTNYCESICQECFINQERKL 28



 Score = 36.3 bits (80), Expect = 0.024
 Identities = 19/33 (57%), Positives = 24/33 (72%), Gaps = 1/33 (3%)
 Frame = -3

Query: 96  RRTS-AKAFAKGVFINQERKLEVRRRLDTALVL 1
           R+T+  ++  +  FINQERKLE RRR DT LVL
Sbjct: 8   RKTNYCESICQECFINQERKLEDRRRSDTVLVL 40


>SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 17/27 (62%), Positives = 18/27 (66%)
 Frame = -2

Query: 118 VKFLDRRKTNISESICQRCFHQSRTKV 38
           VKFLD RKTN  ESICQ CF     K+
Sbjct: 2   VKFLDLRKTNYCESICQECFINQERKL 28



 Score = 36.3 bits (80), Expect = 0.024
 Identities = 19/33 (57%), Positives = 24/33 (72%), Gaps = 1/33 (3%)
 Frame = -3

Query: 96  RRTS-AKAFAKGVFINQERKLEVRRRLDTALVL 1
           R+T+  ++  +  FINQERKLE RRR DT LVL
Sbjct: 8   RKTNYCESICQECFINQERKLEDRRRSDTVLVL 40


>SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 180

 Score = 37.9 bits (84), Expect = 0.008
 Identities = 22/59 (37%), Positives = 29/59 (49%)
 Frame = -1

Query: 587 TLTRPRNRNEYTLNILTRNNWRASLXXXXXXXXXXXAYTKIVAVKKLXVAFVRRAVGAP 411
           T  +   R    ++++ R +WRASL           AY K+VAVKKL V F    VG P
Sbjct: 44  TCQQTTTRVHAAMHLVIRIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 102


>SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 46

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 19/33 (57%), Positives = 24/33 (72%), Gaps = 1/33 (3%)
 Frame = -3

Query: 96  RRTS-AKAFAKGVFINQERKLEVRRRLDTALVL 1
           R+T+  ++  +  FINQERKLE RRR DT LVL
Sbjct: 8   RKTNYCESICQECFINQERKLEDRRRSDTVLVL 40



 Score = 29.9 bits (64), Expect = 2.1
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = -2

Query: 115 KFLDRRKTNISESICQRCFHQSRTKV 38
           + L  RKTN  ESICQ CF     K+
Sbjct: 3   EILGFRKTNYCESICQECFINQERKL 28


>SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 57

 Score = 35.1 bits (77), Expect = 0.055
 Identities = 20/42 (47%), Positives = 22/42 (52%)
 Frame = -1

Query: 536 RNNWRASLXXXXXXXXXXXAYTKIVAVKKLXVAFVRRAVGAP 411
           R +WRASL           AY K+VAVKKL V F    VG P
Sbjct: 14  RIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 55


>SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 18/38 (47%), Positives = 19/38 (50%)
 Frame = -1

Query: 524 RASLXXXXXXXXXXXAYTKIVAVKKLXVAFVRRAVGAP 411
           RASL           AY K+VAVKKL V F    VG P
Sbjct: 5   RASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 42


>SB_595| Best HMM Match : CH (HMM E-Value=0)
          Length = 905

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 12/26 (46%), Positives = 20/26 (76%), Gaps = 2/26 (7%)
 Frame = -3

Query: 690 RGSLRNGYHILGRQQA--RKLPTPGT 619
           RG++++GY+   +QQA  RK+P PG+
Sbjct: 333 RGTIQSGYYFCKQQQAARRKIPKPGS 358


>SB_13633| Best HMM Match : Glyco_hydro_31 (HMM E-Value=0)
          Length = 663

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = +1

Query: 226 RNIQAAFLARFEHSNLFK--VKLSAHLDTHRRAPR*DFDIEPAFFRTPAHRRYA 381
           +N +   LAR+  + +F   ++  AHLDT RR P    D+     R     RYA
Sbjct: 573 KNPEPELLARWYQTGVFTPFLRAHAHLDTKRREPWLFDDVYKNVIRDALRTRYA 626


>SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5)
          Length = 203

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 10/25 (40%), Positives = 12/25 (48%)
 Frame = +3

Query: 438 CNXELFNRNNFSIRYWSWNYRGCWH 512
           C   +  RN   +RYW W  R C H
Sbjct: 91  CEVTVIARNILPVRYWIWLSRKCGH 115


>SB_35396| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 53

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = -1

Query: 179 QNSEVMINRDNWGHSY-CDVRGEILGSSQDEHQRKHLP 69
           Q  EV  +++  GH Y C   GE++ S++D H+   +P
Sbjct: 7   QCKEVESSKEILGHPYVCAFAGEVIQSTEDVHKPSWIP 44


>SB_24390| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 397

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%)
 Frame = +3

Query: 375 ICSANVSVSPRMRCTDSAAHKCNXELFNRNNFSIRYW-SWNY 497
           I S     S R+RCT S + KC     + + F    W S+NY
Sbjct: 139 ISSGYYGRSYRLRCTSSTSWKCRLTSISESYFKGNNWFSYNY 180


>SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 67

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 18/42 (42%), Positives = 19/42 (45%)
 Frame = -1

Query: 536 RNNWRASLXXXXXXXXXXXAYTKIVAVKKLXVAFVRRAVGAP 411
           R    ASL           AY K+VAVKKL V F    VG P
Sbjct: 24  RERRAASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 65


>SB_1307| Best HMM Match : Filament (HMM E-Value=0.13)
          Length = 916

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 9/32 (28%), Positives = 17/32 (53%)
 Frame = -2

Query: 658 RKAAGAQITHSRHGEVVTKNIDTGLLRGLVIG 563
           R  + + ++H  HG   T+N+ +G+   L  G
Sbjct: 673 RSRSTSNLSHGNHGSTTTRNMSSGIQSNLAFG 704


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,711,743
Number of Sequences: 59808
Number of extensions: 418587
Number of successful extensions: 1117
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 1017
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1117
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1829596184
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).