SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0001
         (944 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_29066| Best HMM Match : No HMM Matches (HMM E-Value=.)             114   1e-25

>SB_29066| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 212

 Score =  114 bits (274), Expect = 1e-25
 Identities = 53/75 (70%), Positives = 62/75 (82%)
 Frame = +2

Query: 458 EQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMV 637
           EQLMEL+          GLKRKP+AL+K+LR+AKKEA P EKPE+VKTHLRNMIIVPEM+
Sbjct: 35  EQLMELVCCRQRRRFTRGLKRKPLALMKRLRKAKKEAAPMEKPEVVKTHLRNMIIVPEMI 94

Query: 638 GSIVGIYNGKTFNQV 682
           GS+VG+YNGKTF QV
Sbjct: 95  GSVVGVYNGKTFTQV 109



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 20/26 (76%), Positives = 23/26 (88%)
 Frame = +3

Query: 162 DETLKKKRIFRKFTYRGVDLDQLLDM 239
           D  +K+KR FRKFTYRGVDLDQLLD+
Sbjct: 7   DAQIKRKRTFRKFTYRGVDLDQLLDL 32


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,000,792
Number of Sequences: 59808
Number of extensions: 460662
Number of successful extensions: 916
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 848
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 915
length of database: 16,821,457
effective HSP length: 82
effective length of database: 11,917,201
effective search space used: 2764790632
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).