SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0044
         (613 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_24811| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.2  
SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12)                29   3.0  
SB_39161| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.2  
SB_19371| Best HMM Match : C_tripleX (HMM E-Value=0.041)               28   6.9  
SB_8335| Best HMM Match : Dehydrin (HMM E-Value=7.2)                   28   6.9  
SB_11344| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.1  

>SB_24811| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 619

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = -3

Query: 284 CISNTGCLLLKITVQNNLTIVYHKCVFIIY 195
           C+S T CLLL ITV   L++ Y   +F+ Y
Sbjct: 217 CLSVTVCLLLSITVCPLLSVCYCPLLFVRY 246


>SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12)
          Length = 923

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 17/42 (40%), Positives = 21/42 (50%)
 Frame = -1

Query: 424 HAVTVGREFDRVCGRPRSTRESQLDRVRRPRSAASHRDGRTR 299
           HAV        + GR +   +S LDRVR PR   SH+  R R
Sbjct: 461 HAVKPAFHGGSLRGRYQRDMDSVLDRVRAPRVLDSHKRDRYR 502


>SB_39161| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2103

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 7/65 (10%)
 Frame = +1

Query: 277  EIQRGIFLSFVRHGVKRPNGVVEPGLTAIRVLIVAG-------RTRDRIHDQQLRRGSSI 435
            E Q    LSF +     P G+V  G+    VL++A        R R RI D  L +G+  
Sbjct: 1042 ETQGSTLLSFFKEFRLFPQGIVAIGIVLFLVLVIAAIVLVCKWRKRRRIRDMDLTQGTEH 1101

Query: 436  KVNQT 450
            +  +T
Sbjct: 1102 ETIRT 1106


>SB_19371| Best HMM Match : C_tripleX (HMM E-Value=0.041)
          Length = 942

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 10/34 (29%), Positives = 19/34 (55%)
 Frame = +3

Query: 306 RPSRCEAAERGRRTRSNCDSRVDRGRPHTRSNSR 407
           + ++C    +G+ T  +CD   +RG+   R N+R
Sbjct: 366 KTAKCALTCKGKGTYGSCDQTCERGKCQLRCNTR 399


>SB_8335| Best HMM Match : Dehydrin (HMM E-Value=7.2)
          Length = 531

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 1/39 (2%)
 Frame = -1

Query: 406 REFDRVC-GRPRSTRESQLDRVRRPRSAASHRDGRTREK 293
           RE DR   GRPR +R+++  R  RPR   + RD R +E+
Sbjct: 291 READRSRDGRPRESRDAERPRDCRPRE--TDRDPRDKER 327


>SB_11344| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 492

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 15/36 (41%), Positives = 20/36 (55%)
 Frame = +2

Query: 401 FTTNSYGVGLVSKLIKPKTVVQFYISCFSTIKHATI 508
           +T N Y + L SKL K KT + FYI+      H T+
Sbjct: 247 YTNNDYSICLDSKLNKRKT-IGFYINNLLQHSHITL 281


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,574,330
Number of Sequences: 59808
Number of extensions: 337422
Number of successful extensions: 942
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 891
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 941
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1499981500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).