SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0039
         (616 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)             188   4e-48
SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)              188   4e-48
SB_56| Best HMM Match : Actin (HMM E-Value=0)                         188   4e-48
SB_56628| Best HMM Match : Actin (HMM E-Value=0)                      188   4e-48
SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)              188   4e-48
SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)             108   4e-24
SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)             105   2e-23
SB_54| Best HMM Match : Actin (HMM E-Value=0)                          85   4e-17
SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)             65   5e-11
SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)                  61   6e-10
SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)                  60   2e-09
SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)               54   1e-07
SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)                 51   6e-07
SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   4e-04
SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_3885| Best HMM Match : Actin (HMM E-Value=0.77)                     35   0.046
SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)                  35   0.060
SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.56 
SB_18097| Best HMM Match : NadA (HMM E-Value=2.2)                      31   0.56 
SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)                    31   0.56 
SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.74 
SB_21074| Best HMM Match : NadA (HMM E-Value=2)                        31   0.74 
SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8)                    31   0.74 
SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.74 
SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0)                       31   0.74 
SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   0.74 
SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28)                    31   0.98 
SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.3  
SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28)                    29   3.0  
SB_16847| Best HMM Match : S-AdoMet_synt_M (HMM E-Value=0)             29   3.0  
SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)              29   3.0  
SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.0  
SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.0  
SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2)                   29   3.0  
SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27)                 29   3.0  
SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39)                 29   3.0  
SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)              29   3.0  
SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0)                       29   4.0  
SB_31419| Best HMM Match : Laminin_EGF (HMM E-Value=7)                 28   5.2  
SB_23472| Best HMM Match : HIT (HMM E-Value=0.43)                      28   5.2  
SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.2  
SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028)                   28   5.2  
SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.2  
SB_10843| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.2  
SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.2  
SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32)                 28   5.2  
SB_12041| Best HMM Match : PHD (HMM E-Value=0.001)                     28   5.2  
SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0)                       28   5.2  
SB_40186| Best HMM Match : Extensin_2 (HMM E-Value=0.0036)             28   6.9  
SB_36120| Best HMM Match : zf-MIZ (HMM E-Value=3.9)                    27   9.1  
SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0)                       27   9.1  
SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.1  
SB_15607| Best HMM Match : zf-MIZ (HMM E-Value=3.9)                    27   9.1  
SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015)                   27   9.1  
SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.1  
SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0)                       27   9.1  

>SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 376

 Score =  188 bits (457), Expect = 4e-48
 Identities = 92/119 (77%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 166



 Score =  109 bits (263), Expect = 1e-24
 Identities = 50/53 (94%), Positives = 52/53 (98%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           M D+E+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MEDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 375

 Score =  188 bits (457), Expect = 4e-48
 Identities = 92/119 (77%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  107 bits (256), Expect = 9e-24
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>SB_56| Best HMM Match : Actin (HMM E-Value=0)
          Length = 375

 Score =  188 bits (457), Expect = 4e-48
 Identities = 92/119 (77%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 165



 Score =  108 bits (259), Expect = 4e-24
 Identities = 49/51 (96%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           ++EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52


>SB_56628| Best HMM Match : Actin (HMM E-Value=0)
          Length = 376

 Score =  188 bits (457), Expect = 4e-48
 Identities = 92/119 (77%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 166



 Score =  114 bits (274), Expect = 6e-26
 Identities = 51/53 (96%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 349

 Score =  188 bits (457), Expect = 4e-48
 Identities = 92/119 (77%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN+PAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVSHTVPI 166



 Score =  109 bits (263), Expect = 1e-24
 Identities = 48/53 (90%), Positives = 52/53 (98%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           M D+++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 338

 Score =  108 bits (259), Expect = 4e-24
 Identities = 48/51 (94%), Positives = 51/51 (100%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D++VAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 2   DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 52



 Score = 77.0 bits (181), Expect = 1e-14
 Identities = 35/43 (81%), Positives = 36/43 (83%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF 365
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKI   TF
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIMFETF 90



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 25/52 (48%), Positives = 29/52 (55%)
 Frame = +3

Query: 438 NREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           N + M +IMFETFN+PAMYVAIQA                SGD G+ H  PI
Sbjct: 78  NWDDMEKIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGD-GVTHTVPI 128


>SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 411

 Score =  105 bits (253), Expect = 2e-23
 Identities = 55/132 (41%), Positives = 79/132 (59%), Gaps = 1/132 (0%)
 Frame = +3

Query: 216 SGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPE 392
           S + G    + L+VGDEA   R +L + YP+++GIV NWDDM+ +W +TF  +++ + P 
Sbjct: 44  SQKVGDIEVKDLMVGDEASQLRYMLEVNYPMDNGIVRNWDDMKHVWDYTFGESKMNIDPR 103

Query: 393 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGG 572
              VLLTE PLNP  NREKM ++MFE +    +Y+AIQA        +       SGD G
Sbjct: 104 NTKVLLTEPPLNPMKNREKMIEVMFENYQFEGVYIAIQAVLTLYAQGLLTGVVIDSGD-G 162

Query: 573 LPHPCPILRKGF 608
           + H CP+  +GF
Sbjct: 163 VTHICPVY-EGF 173



 Score = 44.4 bits (100), Expect = 7e-05
 Identities = 17/33 (51%), Positives = 24/33 (72%)
 Frame = +1

Query: 112 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           + +V DNG+G  K G+AG + P  +FPS+VGRP
Sbjct: 7   SVIVCDNGTGFVKCGYAGSNFPAHIFPSMVGRP 39


>SB_54| Best HMM Match : Actin (HMM E-Value=0)
          Length = 2486

 Score = 85.0 bits (201), Expect = 4e-17
 Identities = 42/83 (50%), Positives = 54/83 (65%)
 Frame = +3

Query: 345  KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCT 524
            K+W H F ++LRV  E+ PVLLTEAPLNPK NRE+M Q+MFE+FN P MYVA+QA     
Sbjct: 2130 KMWEHAF-DQLRVRGEDFPVLLTEAPLNPKMNRERMVQLMFESFNVPCMYVAVQAVMALY 2188

Query: 525  RPVVPPVSCWTSGDGGLPHPCPI 593
                   + +  GD G+ H  P+
Sbjct: 2189 ASGRTTGTVFDCGD-GVSHTVPV 2210



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 23/34 (67%), Positives = 30/34 (88%)
 Frame = +1

Query: 118  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 219
            +V+DNGSG CKAG + D++PR VFP+IVGRPRH+
Sbjct: 2097 VVIDNGSGFCKAGLSTDESPRVVFPAIVGRPRHK 2130


>SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40)
          Length = 367

 Score = 64.9 bits (151), Expect = 5e-11
 Identities = 25/39 (64%), Positives = 34/39 (87%)
 Frame = +3

Query: 393 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           +HPVLLTEAPLNP+ NREK  ++ FETFN PA+++++QA
Sbjct: 126 QHPVLLTEAPLNPRRNREKAAEVFFETFNVPALFISMQA 164



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 14/17 (82%), Positives = 17/17 (100%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           +VLSLYA+GRTTG+VLD
Sbjct: 164 AVLSLYATGRTTGVVLD 180


>SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07)
          Length = 240

 Score = 61.3 bits (142), Expect = 6e-10
 Identities = 24/65 (36%), Positives = 42/65 (64%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 482
           PI+ G++ +WD  EKI  + +   ++     HP+L++EA  N +  REK+T++MFE +N 
Sbjct: 3   PIKDGMIEDWDLFEKILDYIYSKNIKSDSALHPLLMSEAAWNTRIKREKLTELMFEKYNV 62

Query: 483 PAMYV 497
           PA ++
Sbjct: 63  PAFFL 67


>SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)
          Length = 1392

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 27/39 (69%), Positives = 29/39 (74%)
 Frame = +1

Query: 103  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 219
            E    LV+D GS M K GFAGDDAP+ VFP IVGRPRHQ
Sbjct: 1354 EAPTPLVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQ 1392


>SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)
          Length = 372

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 29/66 (43%), Positives = 36/66 (54%), Gaps = 2/66 (3%)
 Frame = +3

Query: 219 GRDGRYGTEGL--LVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 392
           GR  + G E L   +GDEA  K    T K+PI H IV +WD ME+ W    +  LR  PE
Sbjct: 273 GRSAK-GVEDLDFFIGDEAIDKPSYAT-KWPIRHAIVEDWDLMERFWEQCIFKYLRAEPE 330

Query: 393 EHPVLL 410
           +H  LL
Sbjct: 331 DHYFLL 336


>SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)
          Length = 921

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 21/49 (42%), Positives = 32/49 (65%)
 Frame = +1

Query: 88  FKMCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 234
           FK+      A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G
Sbjct: 693 FKLDSHYNRAIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIG 741


>SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 198

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 21/39 (53%), Positives = 27/39 (69%)
 Frame = -2

Query: 216 MAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRGNFFV 100
           MA  + D GE+G+ SI+S ETGLAHTGAI+  Q  +  V
Sbjct: 1   MARSADDGGENGSGSIVSGETGLAHTGAIIDNQSCDIIV 39


>SB_38756| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 220

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 3/79 (3%)
 Frame = +3

Query: 219 GRDGRYGTEGLLVGDEAQSKRGIL-TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-- 389
           GR G   + GL VG++  S   I   L+ P +  +VT+++  E++  H F +     P  
Sbjct: 105 GRKGEPDSGGLAVGNDIGSVEMIRWALRTPFDRDVVTHYECQEQVLDHAFSHLGINTPGG 164

Query: 390 EEHPVLLTEAPLNPKANRE 446
             HPV++TE   NP   R+
Sbjct: 165 VNHPVIMTEPVCNPNYCRQ 183


>SB_3885| Best HMM Match : Actin (HMM E-Value=0.77)
          Length = 152

 Score = 35.1 bits (77), Expect = 0.046
 Identities = 21/45 (46%), Positives = 25/45 (55%)
 Frame = +3

Query: 459 IMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           IMFE FN+PA+YVAIQA              + SGD G+ H  PI
Sbjct: 1   IMFEAFNSPAVYVAIQAVLSLYASGRTTGVVFDSGD-GVSHNVPI 44


>SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)
          Length = 580

 Score = 34.7 bits (76), Expect = 0.060
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 2/44 (4%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKY--PIEHGIVTNWDDMEKIWHHTFYNE 374
           L +GD+ +  +    L Y  P + G + NWD  ++IW +TF  E
Sbjct: 272 LFIGDQIEECKDYSALFYVLPFQKGFLVNWDVEKQIWDYTFGKE 315



 Score = 27.9 bits (59), Expect = 6.9
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAV 186
           ++A LV+D G+   K GFA + APR++
Sbjct: 232 KMATLVLDCGACSQKIGFASNQAPRSI 258


>SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 31.5 bits (68), Expect = 0.56
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -3

Query: 191 GNTARGASSPAKPALHIPEPLSTT 120
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_18097| Best HMM Match : NadA (HMM E-Value=2.2)
          Length = 272

 Score = 31.5 bits (68), Expect = 0.56
 Identities = 19/48 (39%), Positives = 24/48 (50%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           L C    ++  V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 213 LTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVPT 259


>SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)
          Length = 170

 Score = 31.5 bits (68), Expect = 0.56
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -3

Query: 191 GNTARGASSPAKPALHIPEPLSTT 120
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 591

 Score = 31.1 bits (67), Expect = 0.74
 Identities = 19/48 (39%), Positives = 24/48 (50%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           L C    ++  V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 408 LTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 454


>SB_21074| Best HMM Match : NadA (HMM E-Value=2)
          Length = 358

 Score = 31.1 bits (67), Expect = 0.74
 Identities = 19/48 (39%), Positives = 24/48 (50%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           L C    ++  V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 271 LTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 317


>SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8)
          Length = 339

 Score = 31.1 bits (67), Expect = 0.74
 Identities = 19/48 (39%), Positives = 24/48 (50%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           L C    ++  V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 249 LTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 295


>SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 181

 Score = 31.1 bits (67), Expect = 0.74
 Identities = 19/48 (39%), Positives = 24/48 (50%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           L C    ++  V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 91  LTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 137


>SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 402

 Score = 31.1 bits (67), Expect = 0.74
 Identities = 19/48 (39%), Positives = 24/48 (50%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           L C    ++  V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 91  LTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 137


>SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 458

 Score = 31.1 bits (67), Expect = 0.74
 Identities = 19/48 (39%), Positives = 24/48 (50%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           L C    ++  V+LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 125 LTCICCKVMEHVVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 171


>SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28)
          Length = 570

 Score = 30.7 bits (66), Expect = 0.98
 Identities = 18/48 (37%), Positives = 24/48 (50%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           L C    ++  ++LSH + H  M     D  +HG RS  SCET L  T
Sbjct: 173 LTCICCKVMEHIVLSHLNSHTAMNNILSDL-QHGFRSGFSCETQLVLT 219


>SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 749

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = -3

Query: 191 GNTARGASSPAKPALHIPEPLSTT 120
           GNT R    PAKP+L++P P S T
Sbjct: 540 GNTNRRTRIPAKPSLNLPSPPSKT 563


>SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28)
          Length = 419

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           L C    ++  ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 242 LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 288


>SB_16847| Best HMM Match : S-AdoMet_synt_M (HMM E-Value=0)
          Length = 192

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 10/21 (47%), Positives = 16/21 (76%)
 Frame = -2

Query: 561 RKSSTIPVVRPDAYSESTLGW 499
           R++ T+P +RPDA S+ T+ W
Sbjct: 48  RRNGTLPWLRPDAKSQVTINW 68


>SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)
          Length = 330

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           L C    ++  ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 103 LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 149


>SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2396

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = -2

Query: 282  LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
            L C    ++  ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 1641 LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 1687


>SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 859

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           L C    ++  ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 669 LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 715


>SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2)
          Length = 329

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           L C    ++  ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 224 LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 270


>SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27)
          Length = 1492

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = -2

Query: 282  LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
            L C    ++  ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 1079 LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 1125


>SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39)
          Length = 452

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           L C    ++  ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 22  LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 68


>SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42)
          Length = 330

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           L C    ++  ++LSH + H L A       +HG R  +SCET L  T
Sbjct: 103 LTCICCKIMEHIVLSHLNKH-LAANNILSIFQHGFRQALSCETQLVLT 149


>SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 885

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 12/39 (30%), Positives = 24/39 (61%)
 Frame = -2

Query: 264 HLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGL 148
           H++ + ++SH +HH ++      + +HG R + SCE+ L
Sbjct: 470 HIITKNIVSHLEHHDILY-----KFQHGFRKLRSCESQL 503


>SB_31419| Best HMM Match : Laminin_EGF (HMM E-Value=7)
          Length = 186

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 21/91 (23%), Positives = 37/91 (40%), Gaps = 2/91 (2%)
 Frame = -1

Query: 397 CSSGATRSSL*KV*CQIFSMSSQLVTIPCSMGYLRVRIPLLLCASS--PTKSPSVPYRPS 224
           CS       +  + C    +  ++V   CS   + V +  ++C+    P +       PS
Sbjct: 88  CSPSRAHVDVFPITCSCRCVPHRMVMSMCSPSRVYVDVSPIVCSCRCVPHRVLMSMCSPS 147

Query: 223 RPDGGAFPRSRGTRREEHHLLRNRPCTYRSH 131
           R D   FP +   R   HH+L +   + R+H
Sbjct: 148 RADVDVFPITCSRRCVFHHVLMSMCSSSRAH 178


>SB_23472| Best HMM Match : HIT (HMM E-Value=0.43)
          Length = 168

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 13/42 (30%), Positives = 22/42 (52%)
 Frame = -2

Query: 264 HLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           H++   +++H D H ++      + +HG R   SCET L  T
Sbjct: 44  HIIFHDIMNHLDTHNILV-----KFQHGFRRFFSCETQLITT 80


>SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = -3

Query: 191 GNTARGASSPAKPALHIPEPLSTT 120
           GNT R     AKPAL++P P S T
Sbjct: 40  GNTNRRTRIQAKPALNLPSPPSKT 63


>SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028)
          Length = 252

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 13/42 (30%), Positives = 22/42 (52%)
 Frame = -2

Query: 264 HLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           H++   +++H D H ++      + +HG R   SCET L  T
Sbjct: 89  HIIFHDIMNHLDTHNILV-----KFQHGFRRFFSCETQLITT 125


>SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 635

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 13/24 (54%), Positives = 14/24 (58%)
 Frame = -3

Query: 191 GNTARGASSPAKPALHIPEPLSTT 120
           GNT R    PAKP L IP P + T
Sbjct: 68  GNTNRRTRIPAKPTLTIPSPPTKT 91


>SB_10843| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1259

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 13/30 (43%), Positives = 15/30 (50%)
 Frame = +2

Query: 419 SPQPQGQQREDDPDHVRNIQHARHVRRHPS 508
           SP P+   R D+P  V     A HV  HPS
Sbjct: 265 SPTPKRCVRFDEPPTVEKYSKASHVTEHPS 294


>SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1134

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 13/42 (30%), Positives = 22/42 (52%)
 Frame = -2

Query: 264 HLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           H++   +++H D H ++      + +HG R   SCET L  T
Sbjct: 673 HIIFHDIMNHIDTHNILV-----KFQHGFRRFFSCETQLITT 709


>SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32)
          Length = 698

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 13/42 (30%), Positives = 22/42 (52%)
 Frame = -2

Query: 264 HLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           H++   +++H D H ++      + +HG R   SCET L  T
Sbjct: 292 HIIFHDIMNHLDTHNILV-----KFQHGFRRFFSCETQLITT 328


>SB_12041| Best HMM Match : PHD (HMM E-Value=0.001)
          Length = 560

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 13/42 (30%), Positives = 22/42 (52%)
 Frame = -2

Query: 264 HLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           H++   +++H D H ++      + +HG R   SCET L  T
Sbjct: 503 HIIFHDIMNHLDTHNILV-----KFQHGFRRFFSCETQLITT 539


>SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 979

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 13/42 (30%), Positives = 22/42 (52%)
 Frame = -2

Query: 264 HLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 139
           H++   +++H D H ++      + +HG R   SCET L  T
Sbjct: 129 HIIFHDIMNHLDTHNILV-----KFQHGFRRFFSCETQLITT 165


>SB_40186| Best HMM Match : Extensin_2 (HMM E-Value=0.0036)
          Length = 362

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 10/28 (35%), Positives = 18/28 (64%)
 Frame = -1

Query: 316 PCSMGYLRVRIPLLLCASSPTKSPSVPY 233
           P ++ +L    PLL+  +SP  SP++P+
Sbjct: 16  PPTIPFLAATTPLLMVTTSPLTSPTIPF 43



 Score = 27.9 bits (59), Expect = 6.9
 Identities = 10/28 (35%), Positives = 18/28 (64%)
 Frame = -1

Query: 316 PCSMGYLRVRIPLLLCASSPTKSPSVPY 233
           P ++ +L    PLL+  +SP  SP++P+
Sbjct: 82  PPTIPFLATTTPLLMVTTSPLPSPTIPF 109


>SB_36120| Best HMM Match : zf-MIZ (HMM E-Value=3.9)
          Length = 209

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGL---AHTGAIVYYQRG 112
           L C    ++  V+LSH + H L A       +HG R+  SCET L    H  A +  + G
Sbjct: 93  LTCLACKVMEHVVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKHG 151

Query: 111 NFFVAHLE 88
              V  L+
Sbjct: 152 QVDVLLLD 159


>SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 522

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGL---AHTGAIVYYQRG 112
           L C    ++  V+LSH + H L A       +HG R+  SCET L    H  A +  + G
Sbjct: 93  LTCLACKVMEHVVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKHG 151

Query: 111 NFFVAHLE 88
              V  L+
Sbjct: 152 QVDVLLLD 159


>SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 285

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 12/37 (32%), Positives = 21/37 (56%)
 Frame = -3

Query: 206 LPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSSH 96
           L  IE +    A++P  P + +P+ +   +AAT +SH
Sbjct: 222 LRRIERSNIPQATAPGTPGVPVPQAVHGVSAATQASH 258


>SB_15607| Best HMM Match : zf-MIZ (HMM E-Value=3.9)
          Length = 221

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGL---AHTGAIVYYQRG 112
           L C    ++  V+LSH + H L A       +HG R+  SCET L    H  A +  + G
Sbjct: 126 LTCLACKVMEHVVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKHG 184

Query: 111 NFFVAHLE 88
              V  L+
Sbjct: 185 QVDVLLLD 192


>SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015)
          Length = 224

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGL---AHTGAIVYYQRG 112
           L C    ++  V+LSH + H L A       +HG R+  SCET L    H  A +  + G
Sbjct: 43  LTCLACKVMEHVVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKHG 101

Query: 111 NFFVAHLE 88
              V  L+
Sbjct: 102 QVDVLLLD 109


>SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1676

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGL---AHTGAIVYYQRG 112
           L C    ++  V+LSH + H L A       +HG R+  SCET L    H  A +  + G
Sbjct: 715 LTCLACKVMEHVVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKHG 773

Query: 111 NFFVAHLE 88
              V  L+
Sbjct: 774 QVDVLLLD 781


>SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 1176

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
 Frame = -2

Query: 282 LFCSVPHLLLRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGL---AHTGAIVYYQRG 112
           L C    ++  V+LSH + H L A       +HG R+  SCET L    H  A +  + G
Sbjct: 799 LTCLACKVMEHVVLSHLNKH-LAAHNIISNLQHGFRAGFSCETQLILAVHDWASILNKHG 857

Query: 111 NFFVAHLE 88
              V  L+
Sbjct: 858 QVDVLLLD 865


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,948,627
Number of Sequences: 59808
Number of extensions: 562782
Number of successful extensions: 1905
Number of sequences better than 10.0: 56
Number of HSP's better than 10.0 without gapping: 1641
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1891
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1512078125
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).