SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0038
         (638 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_33521| Best HMM Match : Utp14 (HMM E-Value=0.48)                    29   3.2  
SB_26230| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_44648| Best HMM Match : UPF0005 (HMM E-Value=0.00022)               28   5.6  
SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0)               28   5.6  
SB_55929| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  

>SB_33521| Best HMM Match : Utp14 (HMM E-Value=0.48)
          Length = 947

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 15/46 (32%), Positives = 20/46 (43%)
 Frame = -1

Query: 620 LHINKPTLQTLPVLNSVKDKFDSNPPNLLSIHL*ISNRYNYEISVH 483
           L + K TL     +  V  K    PPN+L  H+ I N  N  +  H
Sbjct: 571 LDVRKKTLDVYKEIPDVNKKNPKKPPNILDEHIKIPNVINKNLYDH 616


>SB_26230| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 344

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 13/29 (44%), Positives = 16/29 (55%)
 Frame = -2

Query: 100 DEHTVYPAESLVVTVAHRYKQSQKYSHSI 14
           D H   P ES V T   R +QSQ+ +H I
Sbjct: 258 DSHNELPKESTVTTSYPRNRQSQRVTHGI 286


>SB_44648| Best HMM Match : UPF0005 (HMM E-Value=0.00022)
          Length = 192

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 15/47 (31%), Positives = 26/47 (55%)
 Frame = -2

Query: 244 DYKVGFLIVSEFLFGVRVNEAILCYVFLLNFFHSIPSSILIAMEGAL 104
           +++  F ++  FLF   +   ++C+ FL  FFH+    I+ A  GAL
Sbjct: 94  NFQYDFTMMGGFLFVALI--VLICFGFLAIFFHNRVVQIVYASLGAL 138


>SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0)
          Length = 268

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 29/97 (29%), Positives = 44/97 (45%), Gaps = 5/97 (5%)
 Frame = -2

Query: 292 TVCLKQTQHYK--SLYSCDYKVGFLIVS---EFLFGVRVNEAILCYVFLLNFFHSIPSSI 128
           +V + Q +HYK  S+  C   +  L+ S   E L+        L YV  LN    + S  
Sbjct: 114 SVVMFQRRHYKKISMLMC-VLIPTLVPSLWGESLWNAYFTSFALRYVITLNVTWCVNS-- 170

Query: 127 LIAMEGALEDEHTVYPAESLVVTVAHRYKQSQKYSHS 17
           +  M G    + T+ PAE+L VT+A   +    Y H+
Sbjct: 171 IAHMWGDKPYDVTINPAENLFVTLATSGEGYHNYHHT 207


>SB_55929| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 931

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = -2

Query: 262 KSLYSCDYKVGFLIVSEFLFG 200
           K  +SC YK G L+ + FLFG
Sbjct: 479 KCRFSCGYKYGILLGAVFLFG 499


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,198,033
Number of Sequences: 59808
Number of extensions: 378249
Number of successful extensions: 747
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 716
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 747
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1608851125
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).