SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0036
         (602 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_4655| Best HMM Match : Spectrin (HMM E-Value=0)                     80   2e-15
SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.)              77   8e-15
SB_7706| Best HMM Match : Spectrin (HMM E-Value=0)                     68   5e-12
SB_42689| Best HMM Match : Spectrin (HMM E-Value=0)                    62   3e-10
SB_29386| Best HMM Match : Spectrin (HMM E-Value=1.9e-29)              60   1e-09
SB_50472| Best HMM Match : No HMM Matches (HMM E-Value=.)              51   6e-07
SB_33210| Best HMM Match : Spectrin (HMM E-Value=1.3e-12)              49   3e-06
SB_15107| Best HMM Match : Spectrin (HMM E-Value=1.8e-13)              47   1e-05
SB_2411| Best HMM Match : No HMM Matches (HMM E-Value=.)               47   1e-05
SB_59804| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   4e-05
SB_38289| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_5418| Best HMM Match : Spectrin (HMM E-Value=1.50001e-40)           39   0.004
SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.004
SB_53744| Best HMM Match : Spectrin (HMM E-Value=1.8e-28)              37   0.011
SB_7010| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.044
SB_32817| Best HMM Match : Spectrin (HMM E-Value=3.7e-21)              35   0.058
SB_48318| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.24 
SB_27367| Best HMM Match : rve (HMM E-Value=9.5e-17)                   33   0.24 
SB_27735| Best HMM Match : Retrotrans_gag (HMM E-Value=0.097)          33   0.24 
SB_19685| Best HMM Match : Retrotrans_gag (HMM E-Value=0.061)          33   0.24 
SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.54 
SB_32265| Best HMM Match : Bim_N (HMM E-Value=1.5)                     31   0.54 
SB_9739| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   0.54 
SB_42397| Best HMM Match : rve (HMM E-Value=0.0007)                    31   0.72 
SB_11337| Best HMM Match : Bim_N (HMM E-Value=0.45)                    31   0.72 
SB_56471| Best HMM Match : RVT_1 (HMM E-Value=0.00041)                 31   0.72 
SB_37908| Best HMM Match : Retrotrans_gag (HMM E-Value=0.067)          30   1.3  
SB_14964| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.3  
SB_1237| Best HMM Match : rve (HMM E-Value=0.00029)                    30   1.3  
SB_31861| Best HMM Match : rve (HMM E-Value=3.6e-07)                   30   1.3  
SB_29927| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.3  
SB_27036| Best HMM Match : RVT_1 (HMM E-Value=0.00041)                 30   1.3  
SB_10546| Best HMM Match : Bim_N (HMM E-Value=0.83)                    30   1.3  
SB_59115| Best HMM Match : Spectrin (HMM E-Value=0)                    30   1.7  
SB_54885| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.2  
SB_22904| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.03)           29   2.9  
SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05)              29   2.9  
SB_45859| Best HMM Match : RVT_1 (HMM E-Value=0.0014)                  28   5.1  
SB_45545| Best HMM Match : Vicilin_N (HMM E-Value=1.1)                 28   5.1  
SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.1  
SB_35552| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.1  
SB_910| Best HMM Match : Cation_efflux (HMM E-Value=0.056)             28   5.1  
SB_55826| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.8  
SB_54429| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.8  
SB_50061| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   8.8  
SB_44676| Best HMM Match : Bim_N (HMM E-Value=0.83)                    27   8.8  
SB_41836| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.5e-07)        27   8.8  

>SB_4655| Best HMM Match : Spectrin (HMM E-Value=0)
          Length = 934

 Score = 79.8 bits (188), Expect = 2e-15
 Identities = 43/105 (40%), Positives = 63/105 (60%)
 Frame = -1

Query: 539 KYQQFETRL**N*RLGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEIT 360
           K QQFE R     ++   E  K A D+SY D TNL GK+QKHQ FE EL AN+ R+D + 
Sbjct: 539 KLQQFE-RDADEVKVWINEKLKTAKDESYKDLTNLQGKIQKHQAFEAELNANQSRLDAVD 597

Query: 359 AVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RETSCRKR 225
             G +L+  +H+A  QI  R++EL  +W  L + S+ +  + +K+
Sbjct: 598 NSGHQLISADHYASQQIQERLDELHEMWRNLFKHSNNKVQNLQKK 642



 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 31/78 (39%), Positives = 48/78 (61%)
 Frame = -1

Query: 485 ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
           E  + A+D+SY DP NL  K+QKHQ FE E+ A+   + E+T  G+ ++   H+A   I 
Sbjct: 66  EKLQIASDESYRDPMNLQDKLQKHQAFEAEISAHSYAITELTDTGEEMINESHYASEDIR 125

Query: 305 SRVEELGGIWERLVQSSS 252
            R++EL  +WE L+  S+
Sbjct: 126 ERLDELIRLWELLLSKSA 143



 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 27/73 (36%), Positives = 42/73 (57%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG+ L ++ Q  QY   V + + WL E E  + S DYGKD  S Q + KKH  + +D+ +
Sbjct: 765 KGH-LDDSLQSHQYLVDVSEADSWLMEKEPVVTSSDYGKDEDSAQAMLKKHEAIMSDLEA 823

Query: 69  HAERIDAIREPGR 31
           ++  ID +RE  +
Sbjct: 824 YSTVIDGLREQSK 836



 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 24/74 (32%), Positives = 46/74 (62%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +  KL+E+ + QQ+ R  +++++W++E       E Y KDLT++Q   +KH   EA++
Sbjct: 528 EARRLKLEESRKLQQFERDADEVKVWINEKLKTAKDESY-KDLTNLQGKIQKHQAFEAEL 586

Query: 75  SSHAERIDAIREPG 34
           +++  R+DA+   G
Sbjct: 587 NANQSRLDAVDNSG 600



 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 22/67 (32%), Positives = 41/67 (61%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  +L+ A +   + R  ++ + W++E +  L S+DYGKDL SV  L +KH  LE D++
Sbjct: 250 MRKERLESAHEIHSFYRDADETKNWINEKDKVLSSDDYGKDLASVNALSRKHEALERDLA 309

Query: 72  SHAERID 52
           +  ++ D
Sbjct: 310 ALEDKSD 316



 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 20/74 (27%), Positives = 47/74 (63%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           +L+  +L++A +  Q+ R  +++E W++E + Q+ S++  +D  ++Q+  +KH   EA++
Sbjct: 38  KLRRRRLEDAKRYFQFKRDADEVEDWINE-KLQIASDESYRDPMNLQDKLQKHQAFEAEI 96

Query: 75  SSHAERIDAIREPG 34
           S+H+  I  + + G
Sbjct: 97  SAHSYAITELTDTG 110



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG  L  A ++  Y R V+++  W+SE E    SE+ G+DL  V  LQKK      D+ +
Sbjct: 145 KGRMLLFAQKRVHYLREVDEVMSWISEKEAIATSEEIGRDLEHVVVLQKKFDDFLKDLQA 204

Query: 69  HAERIDAIRE 40
           +  R+  I +
Sbjct: 205 NESRVTYIND 214



 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 17/25 (68%), Positives = 22/25 (88%)
 Frame = -3

Query: 120 VQNLQKKHALLEADVSSHAERIDAI 46
           VQNLQKKH L+EADV +H E+I+A+
Sbjct: 636 VQNLQKKHGLIEADVITHIEKIEAV 660



 Score = 35.9 bits (79), Expect = 0.025
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = -1

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           +K  +F ++LQAN+ RV  I  +  +L E  H     IS + +E+   WERL
Sbjct: 193 KKFDDFLKDLQANESRVTYINDLADQLAEEGHPDMELISMKQQEVNEAWERL 244



 Score = 33.9 bits (74), Expect = 0.10
 Identities = 14/59 (23%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = -1

Query: 473 FATDDSYLDPTN-LNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSR 300
           F  D++  D  + +   ++KH++FE    A + +   I     RL++ +H+A+ +++ R
Sbjct: 454 FLADETLGDSLDEVEAMIKKHEDFENSFAAQEEKFKNIDDFANRLIDGDHYAKDEVAER 512



 Score = 30.7 bits (66), Expect = 0.95
 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 3/31 (9%)
 Frame = -2

Query: 565 ALLGKTALQS---INSSKRDCDKTKGWVNEK 482
           A++ K  L+S   I+S  RD D+TK W+NEK
Sbjct: 248 AVMRKERLESAHEIHSFYRDADETKNWINEK 278


>SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3213

 Score = 77.4 bits (182), Expect = 8e-15
 Identities = 34/62 (54%), Positives = 46/62 (74%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KGNKLQ+A +Q+Q NRA+ED+ +W++E E  L  ED G+DL  V+ L KKH LLE+D+  
Sbjct: 731 KGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIEM 790

Query: 69  HA 64
           HA
Sbjct: 791 HA 792



 Score = 70.9 bits (166), Expect = 7e-13
 Identities = 30/74 (40%), Positives = 49/74 (66%)
 Frame = -3

Query: 267  GAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
            G + + K  +L+EA Q+Q + R V +++ W+ EVE  L SEDYGKD+ SV NL K+H  L
Sbjct: 1884 GDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSL 1943

Query: 87   EADVSSHAERIDAI 46
            + D++ + +R+  +
Sbjct: 1944 QMDIARYEDRVSEL 1957



 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 31/73 (42%), Positives = 48/73 (65%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            ATD+S+ DP NL  K+QKHQ FE EL A++  +D +   G++L+   HFA  ++  R+E 
Sbjct: 1337 ATDESFKDPINLESKLQKHQAFESELTAHERAIDSVRDKGEQLISCGHFAASEVEVRIEA 1396

Query: 290  LGGIWERLVQSSS 252
            L   WE L+++S+
Sbjct: 1397 LYIQWEELLEASA 1409



 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 28/73 (38%), Positives = 42/73 (57%)
 Frame = -1

Query: 485  ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
            E  + A + SY + TNL  K+QKHQ FE E+ A+K  +D IT  G+ L+      Q  + 
Sbjct: 1811 EKLQIAAEASYREATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVE 1870

Query: 305  SRVEELGGIWERL 267
            SR+++L  +W  L
Sbjct: 1871 SRLKDLADLWSLL 1883



 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 26/68 (38%), Positives = 41/68 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG KLQEA   QQ+N+ V+  +  +++ E  +LS DYG+D      LQ+K    + D++ 
Sbjct: 1411 KGRKLQEARDHQQFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDLAV 1470

Query: 69   HAERIDAI 46
             A R++AI
Sbjct: 1471 DAARVEAI 1478



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 5/73 (6%)
 Frame = -1

Query: 488 RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAV--GKRLL--ELEHFA 321
           +E  + A D+S+ DP NL G +Q+HQ FE E+ ANK  +D I  V  G  L+   +  ++
Sbjct: 624 KEKSQIAEDESFKDPKNLQGNLQRHQAFEAEITANKDGIDRINKVRFGSTLVVGYVGGWS 683

Query: 320 QPQ-ISSRVEELG 285
           +P  IS+R+ + G
Sbjct: 684 KPSYISNRIHKAG 696



 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 21/70 (30%), Positives = 38/70 (54%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L ++   Q+Y     + + W+++  G   S+DYGKD  S + L  +H  L+ DV++ + 
Sbjct: 946  RLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFST 1005

Query: 60   RIDAIREPGR 31
             ID + E  R
Sbjct: 1006 TIDELAEEAR 1015



 Score = 48.0 bits (109), Expect = 6e-06
 Identities = 22/71 (30%), Positives = 40/71 (56%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + +  KLQ +    QY   V +++ W+SE    + S DYG+D TS + L +KH  L+ ++
Sbjct: 2177 QTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLEL 2236

Query: 75   SSHAERIDAIR 43
             ++  +I  +R
Sbjct: 2237 DANESKIRDLR 2247



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 23/74 (31%), Positives = 45/74 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +  KL E+    Q+ R  +++E W++E + Q+ +E   ++ T++Q   +KH   EA+VS+
Sbjct: 1785 RSGKLGESKLLFQFLRDAKELESWMNE-KLQIAAEASYREATNLQQKLQKHQTFEAEVSA 1843

Query: 69   HAERIDAIREPGRA 28
            H   +DAI + G++
Sbjct: 1844 HKSELDAITQTGQS 1857



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/74 (31%), Positives = 39/74 (52%)
 Frame = -3

Query: 267  GAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
            GA    +  +LQ   + Q++ R  + +E WL+  E  LLSED G  L +V+ L KK    
Sbjct: 2600 GASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKKQDEF 2659

Query: 87   EADVSSHAERIDAI 46
            E  + +  E+ +++
Sbjct: 2660 EKMLLTQGEKFNSL 2673



 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L++A    Q+   +E    W+ E   Q  S D G  L SVQ LQK+H   E ++++H  R
Sbjct: 841  LEDAFALHQFIYDIEVEMTWVREHLQQASSGDLGTSLISVQRLQKRHLAFENELTNHQTR 900

Query: 57   IDAIREPGR 31
            ID +   G+
Sbjct: 901  IDTVLSSGQ 909



 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIEL-WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
            +LQ++    Q+  A   +E+ W+ + E    SEDYG++L  VQ+L KK   LE++++SH 
Sbjct: 2076 RLQDSLALHQF-LADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHE 2134

Query: 63   ERIDAIREPG 34
              + A+ E G
Sbjct: 2135 LLVQALLETG 2144



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 21/60 (35%), Positives = 34/60 (56%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L E+ +  +Y R VE+I  ++SE      SEDYG D   +Q +Q +    +  V+S+AE
Sbjct: 1052 RLTESKKLHEYRREVEEISAYVSEQLQTAASEDYGTDFEHLQVIQGRFGDFQRSVASYAE 1111



 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 18/60 (30%), Positives = 36/60 (60%)
 Frame = -1

Query: 422  QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RE 243
            ++H  FE EL  ++ R+D + + G+ L++  + A  ++  R EEL  +W+ LV  ++ R+
Sbjct: 885  KRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRK 944



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 20/77 (25%), Positives = 45/77 (58%)
 Frame = -3

Query: 264  AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
            A  + +  KLQ + +  Q+ + V + E W+ E + Q  +++  KD  ++++  +KH   E
Sbjct: 1301 AELDKRREKLQNSHKIMQFYQDVVESESWIME-KLQTATDESFKDPINLESKLQKHQAFE 1359

Query: 84   ADVSSHAERIDAIREPG 34
            +++++H   ID++R+ G
Sbjct: 1360 SELTAHERAIDSVRDKG 1376



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/67 (28%), Positives = 37/67 (55%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L ++++   + R  +++  W+ E E  + S+D G+DL  V+ L +K  +   D+ S  E
Sbjct: 2288 RLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGE 2347

Query: 60   RIDAIRE 40
            RI  + E
Sbjct: 2348 RIAKLTE 2354



 Score = 37.1 bits (82), Expect = 0.011
 Identities = 17/72 (23%), Positives = 37/72 (51%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E++   LQ+A +   +    ED++LW+S  E Q  S +    L ++Q +++K      ++
Sbjct: 176 EMRRLSLQKAIKYYHFCHECEDMDLWMSNKERQFKSIESQNTLDAIQTVRQKLERFATEI 235

Query: 75  SSHAERIDAIRE 40
           ++   R+  I +
Sbjct: 236 ATKCSRVSDINQ 247



 Score = 35.5 bits (78), Expect = 0.033
 Identities = 14/61 (22%), Positives = 33/61 (54%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A++D   D  ++N  +++HQ+ + ++   + RV E+       +  EHF + +I+ R  +
Sbjct: 1922 ASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAAD 1981

Query: 290  L 288
            +
Sbjct: 1982 V 1982



 Score = 34.7 bits (76), Expect = 0.058
 Identities = 15/58 (25%), Positives = 30/58 (51%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            N+   ++ H NFE+ L   +  +  + +  K+ L+++H+    I S+  E+   WE L
Sbjct: 1721 NVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEAL 1778



 Score = 33.9 bits (74), Expect = 0.10
 Identities = 17/54 (31%), Positives = 29/54 (53%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            KL EA +   +NR   D+   ++E      S + G+DL +V+ L +KH  +E +
Sbjct: 1520 KLAEACEIHAFNRNCRDVSSMINEKAAVQTSGEVGRDLPAVEALIRKHDDVERE 1573



 Score = 30.7 bits (66), Expect = 0.95
 Identities = 15/61 (24%), Positives = 30/61 (49%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A+ D   D  +    + +H+  + ++ A    +DE+    +RL++  HF   +ISS   +
Sbjct: 975  ASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSHFDSEKISSTQRD 1034

Query: 290  L 288
            L
Sbjct: 1035 L 1035



 Score = 30.7 bits (66), Expect = 0.95
 Identities = 16/69 (23%), Positives = 32/69 (46%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQ++   Q +    E  E W+   +    S +  + L +V++L K H   E  +S++ E 
Sbjct: 1683 LQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEEN 1742

Query: 57   IDAIREPGR 31
            I ++    +
Sbjct: 1743 IRSLESSAK 1751



 Score = 30.7 bits (66), Expect = 0.95
 Identities = 13/53 (24%), Positives = 30/53 (56%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            ++K +  E E+ +++  V  +   G++L+   H+A+  I ++ + L  +WE L
Sbjct: 2120 MKKMEGLESEINSHELLVQALLETGEQLVLRGHYAERDIGAKSQMLLELWEEL 2172



 Score = 29.5 bits (63), Expect = 2.2
 Identities = 10/35 (28%), Positives = 21/35 (60%)
 Frame = -3

Query: 195 EDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHAL 91
           E++  W+ E +  L  E+ GKD+ +V+   ++H +
Sbjct: 317 EEMRSWIQEKDAALCKEELGKDIETVRAQLRRHQM 351



 Score = 29.1 bits (62), Expect = 2.9
 Identities = 17/71 (23%), Positives = 39/71 (54%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
            ++KH+N E+ + + + ++  +  +GK L++ +H     I +R   L G+ +R  +  +  
Sbjct: 1247 LKKHENTEKLVLSQEEKLSALQVLGKELIDNQHNQSDMIRNR---LSGVCDRREKLKAEL 1303

Query: 245  ETSCRKRLNNS 213
            +   R++L NS
Sbjct: 1304 DKR-REKLQNS 1313


>SB_7706| Best HMM Match : Spectrin (HMM E-Value=0)
          Length = 686

 Score = 68.1 bits (159), Expect = 5e-12
 Identities = 33/72 (45%), Positives = 48/72 (66%), Gaps = 9/72 (12%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSE---------VEGQLLSEDYGKDLTSVQNLQKKH 97
           K   L+E+ QQQQ+N  ++D++ WL E         VE  L S+D+G+DL SVQNL KKH
Sbjct: 189 KTQHLKESNQQQQFNTNIKDLDFWLGECTNYVWRTQVEASLSSDDFGRDLASVQNLIKKH 248

Query: 96  ALLEADVSSHAE 61
            L+EAD+++H +
Sbjct: 249 QLVEADIAAHED 260



 Score = 68.1 bits (159), Expect = 5e-12
 Identities = 36/101 (35%), Positives = 58/101 (57%), Gaps = 1/101 (0%)
 Frame = -3

Query: 333 RTFCSTSNIVSRGR-AGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQ 157
           R   S  N++ + +    ++ A   +   + +KL E+     + R V+D E W+ E +  
Sbjct: 236 RDLASVQNLIKKHQLVEADIAAHEDMAANRSDKLAESNALHTFYRDVDDEESWIKEKKLL 295

Query: 156 LLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
             SEDYGKDL+ V+NL+KKH  LEA++++H  RI A+ E G
Sbjct: 296 TSSEDYGKDLSGVENLRKKHQRLEAEINNHEPRIAAVTECG 336



 Score = 65.3 bits (152), Expect = 4e-11
 Identities = 34/73 (46%), Positives = 44/73 (60%), Gaps = 2/73 (2%)
 Frame = -1

Query: 464 DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFA--QPQISSRVEE 291
           D+SY DPTNL  K QKHQ FE E++ANK RV E   +G+ L+E    A  +P +  R+  
Sbjct: 115 DESYKDPTNLQSKFQKHQAFEAEVEANKERVLETVNLGEGLIEQNKCAGSEPVVRERITR 174

Query: 290 LGGIWERLVQSSS 252
           +   WE LV  SS
Sbjct: 175 ITTQWELLVTKSS 187



 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 27/63 (42%), Positives = 42/63 (66%)
 Frame = -3

Query: 243 NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
           +KL E+   QQ++R  EDIE+W+SE    +L E Y KD T++Q+  +KH   EA+V ++ 
Sbjct: 84  SKLGESKTIQQFSRDAEDIEVWISEKMQTVLDESY-KDPTNLQSKFQKHQAFEAEVEANK 142

Query: 63  ERI 55
           ER+
Sbjct: 143 ERV 145



 Score = 54.0 bits (124), Expect = 9e-08
 Identities = 25/74 (33%), Positives = 41/74 (55%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           + + +KL ++   QQ+   V++   W++E    + S+DYG  L +VQ L KKH   E D+
Sbjct: 369 DARQHKLDDSLAYQQFGANVDEEISWINEKNTLVGSDDYGDTLAAVQGLLKKHEAFETDL 428

Query: 75  SSHAERIDAIREPG 34
             H ER++ I   G
Sbjct: 429 EVHRERVNDIENAG 442



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 19/57 (33%), Positives = 32/57 (56%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KL + +   Q+N   + +E W+ + EG   SE+ G+DL+SVQ L  K    +A + +
Sbjct: 480 KLNDNSAFLQFNWKADVVESWIGDKEGIARSEELGRDLSSVQTLMTKQETFDAGLQA 536



 Score = 40.7 bits (91), Expect = 9e-04
 Identities = 19/68 (27%), Positives = 36/68 (52%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           +++D   D + +    +KHQ  E E+  ++PR+  +T  G + +E  H    +I +RV+ 
Sbjct: 297 SSEDYGKDLSGVENLRKKHQRLEAEINNHEPRIAAVTECGNKFVEEGHGNADEIKARVDG 356

Query: 290 LGGIWERL 267
           L   W+ L
Sbjct: 357 LQEKWDEL 364



 Score = 32.3 bits (70), Expect = 0.31
 Identities = 12/56 (21%), Positives = 29/56 (51%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQS 258
           ++KH++F + L   + ++ ++      L+  +H+  P I+ R+  +   W  L Q+
Sbjct: 23  IKKHEDFTRALTVQEEKIGKLKENADTLIAADHYDSPVIAERIAAVLARWATLKQA 78


>SB_42689| Best HMM Match : Spectrin (HMM E-Value=0)
          Length = 1317

 Score = 62.5 bits (145), Expect = 3e-10
 Identities = 30/77 (38%), Positives = 49/77 (63%)
 Frame = -1

Query: 485 ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
           E  + A+++SY D +N+ GKV KH+ FE ELQANK R+D+I+  G+ L + +   +P+I 
Sbjct: 358 EKHQVASEESYRDLSNIQGKVMKHEAFEAELQANKERLDQISESGRDLADEKPENKPEID 417

Query: 305 SRVEELGGIWERLVQSS 255
             +++L   W  L + S
Sbjct: 418 ELLQKLDQKWLELAEVS 434



 Score = 58.8 bits (136), Expect = 3e-09
 Identities = 30/72 (41%), Positives = 43/72 (59%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG +L +A Q  Q++R V+D E W++E E  L S +YG +L  VQ LQKKH  L A++  
Sbjct: 543 KGAELDQAMQFFQFDRDVDDEETWINEKEPLLQSTNYGNNLFEVQKLQKKHQTLCAEIDI 602

Query: 69  HAERIDAIREPG 34
           H +  + I   G
Sbjct: 603 HQKHKERICNQG 614



 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 21/65 (32%), Positives = 44/65 (67%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG+KL++A +Q+++N  V+ ++ W+ E+E  +++++   DLT+   L +KH  LE  +++
Sbjct: 437 KGSKLKDAQRQEEFNAGVQTMQEWVKELETVIITQEKATDLTTATRLYQKHKQLEKQINA 496

Query: 69  HAERI 55
             ER+
Sbjct: 497 KKERL 501



 Score = 54.8 bits (126), Expect = 5e-08
 Identities = 27/70 (38%), Positives = 46/70 (65%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L++A Q QQ+ +  ED+  WL+E + Q+ SE+  +DL+++Q    KH   EA++ ++ E
Sbjct: 335 RLRDALQLQQFIQDAEDMYDWLNE-KHQVASEESYRDLSNIQGKVMKHEAFEAELQANKE 393

Query: 60  RIDAIREPGR 31
           R+D I E GR
Sbjct: 394 RLDQISESGR 403



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 21/67 (31%), Positives = 38/67 (56%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L  + Q +QY     + E W+SE E  ++ ++ GKD  S   + K+H  LEA ++ +AE
Sbjct: 652 QLDLSLQAKQYYFDAAEAESWMSEQELNMMGDERGKDEASATEMLKRHETLEAAIADYAE 711

Query: 60  RIDAIRE 40
            ++ + E
Sbjct: 712 TVNELGE 718



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 21/74 (28%), Positives = 41/74 (55%)
 Frame = -3

Query: 261  VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEA 82
            + E +   L+ A +  +Y    +++   + E +  L++E+ G+DL SVQ LQ+ H   EA
Sbjct: 858  LIETRTKMLEAALELHKYYHDAKEVLAMIQEKDN-LMTEELGRDLNSVQQLQRTHQSFEA 916

Query: 81   DVSSHAERIDAIRE 40
            D++    ++  I+E
Sbjct: 917  DLAPLGHQVSGIQE 930



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 20/52 (38%), Positives = 31/52 (59%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKK 100
           E +  KL E  +  Q NR V+D+ELW+++ E    S+D G+DL   + L +K
Sbjct: 753 EERRGKLDETLKLYQLNREVDDLELWIADKEQVAGSQDIGQDLAHCELLIEK 804



 Score = 33.9 bits (74), Expect = 0.10
 Identities = 16/70 (22%), Positives = 36/70 (51%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
            +KL +A    ++  AV+D  LW++++   +L+ +  KD++ V+ L  +H     ++    
Sbjct: 970  DKLHDADDLYRFLIAVQDQMLWMNDMLKHILTYEKAKDVSGVEVLMDQHQSRHVEIEGRE 1029

Query: 63   ERIDAIREPG 34
            E    + + G
Sbjct: 1030 ESFFGVIKMG 1039



 Score = 31.9 bits (69), Expect = 0.41
 Identities = 14/48 (29%), Positives = 24/48 (50%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHF 324
           T +   D T      QKH+  E+++ A K R+ E+ A    +++  HF
Sbjct: 470 TQEKATDLTTATRLYQKHKQLEKQINAKKERLKELDAQAADMVDAGHF 517



 Score = 31.5 bits (68), Expect = 0.54
 Identities = 10/46 (21%), Positives = 26/46 (56%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++KH+ F + +     +++++    +RL    H+AQ +I+ + + L
Sbjct: 273 IKKHEEFSKRMDVQDEKINQMIQFAQRLANDGHYAQDKITEKAQNL 318


>SB_29386| Best HMM Match : Spectrin (HMM E-Value=1.9e-29)
          Length = 181

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 27/66 (40%), Positives = 44/66 (66%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E + + L  A + Q+++R  +D + W+SE +  L S DYG+DL SVQ LQ+KH +LE D+
Sbjct: 116 EQRKDNLDSAQEIQKFHRDADDTKAWISEKDTALSSSDYGRDLASVQALQRKHDVLERDL 175

Query: 75  SSHAER 58
           ++  E+
Sbjct: 176 AALEEK 181



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 20/67 (29%), Positives = 38/67 (56%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +  KL+++  +    R   ++E W+++ E  + SE+ GKD   V+ +QKK    + D+
Sbjct: 10  EERRKKLEDSIHRYTLLREAHELESWINDKEAIVTSEEVGKDFEHVEAMQKKFDDFQKDM 69

Query: 75  SSHAERI 55
           S++  RI
Sbjct: 70  SANEVRI 76


>SB_50472| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 49

 Score = 51.2 bits (117), Expect = 6e-07
 Identities = 22/46 (47%), Positives = 33/46 (71%)
 Frame = -3

Query: 195 EDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           +D + W+SE +  L S DYG+DL SVQ LQ+KH +LE D+++  E+
Sbjct: 4   DDTKAWISEKDTALSSSDYGRDLASVQALQRKHDVLERDLAALEEK 49


>SB_33210| Best HMM Match : Spectrin (HMM E-Value=1.3e-12)
          Length = 186

 Score = 48.8 bits (111), Expect = 3e-06
 Identities = 21/53 (39%), Positives = 37/53 (69%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGRA 28
           +L + +++  LLSEDYGK L  V++L +KH+L+EAD+++ A+R+  +     A
Sbjct: 125 KLNMPDLQIGLLSEDYGKHLLGVEDLLQKHSLVEADIAAQADRVKTVNAQAEA 177



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 17/47 (36%), Positives = 31/47 (65%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           E WL+E +  +  +++G DL +V+   KKH  +E D+ ++ ER++AI
Sbjct: 3   ETWLNENQRLVAVDNFGNDLAAVEAATKKHEAIETDIMAYEERVNAI 49


>SB_15107| Best HMM Match : Spectrin (HMM E-Value=1.8e-13)
          Length = 143

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 24/55 (43%), Positives = 36/55 (65%)
 Frame = -3

Query: 243 NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
           +KL E+   QQ++R  EDIE+W+SE    +L E Y KD T++Q+  +KH   EA+
Sbjct: 90  SKLGESKTIQQFSRDAEDIEVWISEKMQTVLDESY-KDPTNLQSKFQKHQAFEAE 143



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 16/23 (69%), Positives = 17/23 (73%)
 Frame = -1

Query: 464 DDSYLDPTNLNGKVQKHQNFEQE 396
           D+SY DPTNL  K QKHQ FE E
Sbjct: 121 DESYKDPTNLQSKFQKHQAFEAE 143



 Score = 32.3 bits (70), Expect = 0.31
 Identities = 12/56 (21%), Positives = 29/56 (51%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQS 258
           ++KH++F + L   + ++ ++      L+  +H+  P I+ R+  +   W  L Q+
Sbjct: 29  IKKHEDFTRALTVQEEKIGKLKENADTLIAADHYDSPVIAERIAAVLARWATLKQA 84


>SB_2411| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 660

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 22/67 (32%), Positives = 41/67 (61%), Gaps = 2/67 (2%)
 Frame = -1

Query: 461 DSYLDPT--NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           D Y D T  ++N  ++KH+ FE +L A++ RVD+I A+ + L  LE+    ++++R + +
Sbjct: 256 DDYSDATLADINALMKKHEAFESDLAAHQDRVDQIVAIAQELNALEYSKIDEVNARCQNI 315

Query: 287 GGIWERL 267
              W+ L
Sbjct: 316 CDDWKDL 322



 Score = 36.3 bits (80), Expect = 0.019
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           E W +  +  L  +DY    L  +  L KKH   E+D+++H +R+D I
Sbjct: 243 ESWTNGKDAVLSKDDYSDATLADINALMKKHEAFESDLAAHQDRVDQI 290



 Score = 28.3 bits (60), Expect = 5.1
 Identities = 13/59 (22%), Positives = 29/59 (49%)
 Frame = -1

Query: 440 NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
           +L   +Q  Q+ E  + + KP ++E+  + + + +   F  P     +E +   WE+L+
Sbjct: 431 SLEKNLQVLQDLETFITSYKPNIEELEVINQEVQQALIFENPHTKYTMEAMRVGWEQLL 489


>SB_59804| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 676

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 25/70 (35%), Positives = 37/70 (52%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E + N L    Q     R ++     + ++E  L SEDYG+ L  VQN+  KH+L+E+ +
Sbjct: 389 EARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQI 448

Query: 75  SSHAERIDAI 46
            S  ER  AI
Sbjct: 449 QSQHERTLAI 458



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 18/71 (25%), Positives = 41/71 (57%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+++ +   +   VE+ ++++ E +    S++ G+DL S+  LQ++H  LEA+++    
Sbjct: 500 RLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFS 559

Query: 60  RIDAIREPGRA 28
             + I   G+A
Sbjct: 560 HCEGIIAKGQA 570



 Score = 36.3 bits (80), Expect = 0.019
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKD 130
           +L++AAQ  QY     D E W+ E    + SEDYG+D
Sbjct: 606 RLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRD 642



 Score = 35.9 bits (79), Expect = 0.025
 Identities = 20/80 (25%), Positives = 41/80 (51%)
 Frame = -1

Query: 449 DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
           D  +L    Q+H+  E E+       + I A G+ L++  HF   +I +++++L   W +
Sbjct: 536 DLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIK 595

Query: 269 LVQSSS*RETSCRKRLNNSS 210
           L + +  R    R+RL +++
Sbjct: 596 LKELAGTR----RERLKDAA 611



 Score = 31.9 bits (69), Expect = 0.41
 Identities = 14/57 (24%), Positives = 28/57 (49%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           +++ R  +  E WL ++   +  E  G+D  +V+   K+H  +  DV +  ER   +
Sbjct: 296 EKFQRKADLRESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMV 352


>SB_38289| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 560

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/69 (27%), Positives = 39/69 (56%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+E+ + Q + R  ++ E+W++E +  + S DYG DL +   L  KH  +E ++++   
Sbjct: 406 RLEESLKLQSFYRNADEEEMWVTEKDYFVQSTDYGHDLNTAMILLTKHEAVEREMTARNA 465

Query: 60  RIDAIREPG 34
           +  A+   G
Sbjct: 466 QTKAVARNG 474



 Score = 35.5 bits (78), Expect = 0.033
 Identities = 16/66 (24%), Positives = 35/66 (53%)
 Frame = -1

Query: 419 KHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RET 240
           KH+  E+E+ A   +   +   G+ LLE   +A   I +R++ +   W++L  +++ R+ 
Sbjct: 452 KHEAVEREMTARNAQTKAVARNGEELLEAVPYATDTIQNRLDTIRSKWDKLHDNAAYRKK 511

Query: 239 SCRKRL 222
             ++ L
Sbjct: 512 KIQENL 517



 Score = 32.7 bits (71), Expect = 0.24
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           K+QE  + QQ+     DI  W   +E  + ++D G D  S + L KKH
Sbjct: 512 KIQENLKLQQFIAEYNDIMSWCDMMERIVANDDLGYDEHSAEVLVKKH 559


>SB_5418| Best HMM Match : Spectrin (HMM E-Value=1.50001e-40)
          Length = 514

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVS 73
           +G  ++     +QY++  E I +WL E+E +L      G +L +VQ   K H    A+++
Sbjct: 79  RGELVEVKVTSEQYHKLFEVILVWLDELELKLSEVPPVGTELATVQEQLKLHKAFHAELT 138

Query: 72  SHAERIDAIREPG 34
            H   I  I + G
Sbjct: 139 PHQSEITQINQLG 151



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 17/72 (23%), Positives = 37/72 (51%)
 Frame = -1

Query: 428 KVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS* 249
           ++ KH+  + ++ +++P VD ++     LLE        +  +V+EL   W+ ++  S+ 
Sbjct: 237 ELAKHKILQNDILSHEPSVDSLSRAASALLESGETDSTALEGKVQELKTTWDAVLAKSAQ 296

Query: 248 RETSCRKRLNNS 213
           R+    K L +S
Sbjct: 297 RQAELEKALKDS 308


>SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 6406

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 17/72 (23%), Positives = 37/72 (51%)
 Frame = -1

Query: 428  KVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS* 249
            ++ KH+  + ++ +++P VD ++     LLE        +  +V+EL   W+ ++  S+ 
Sbjct: 5083 ELAKHKILQNDILSHEPSVDSLSRAASALLESGETDSTALEGKVQELKTTWDAVLAKSAQ 5142

Query: 248  RETSCRKRLNNS 213
            R+    K L +S
Sbjct: 5143 RQAELEKALKDS 5154



 Score = 35.9 bits (79), Expect = 0.025
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVS 73
            +G  ++     +QY++    I +WL E+E +L      G +L +VQ   K H    A+++
Sbjct: 4925 RGELVEVKVTSEQYHKLFVVILVWLDELELKLSEVPPVGTELATVQEQLKLHKAFHAELT 4984

Query: 72   SHAERIDAIREPG 34
             H   I  I + G
Sbjct: 4985 PHQSEITQINQLG 4997



 Score = 35.1 bits (77), Expect = 0.044
 Identities = 21/79 (26%), Positives = 42/79 (53%), Gaps = 2/79 (2%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLE--LEHFAQPQISSRVEELGGI 279
            +DP +L  +++KH+ F+  L AN+  +D    +GK+L++  L+  A   I  ++ +L   
Sbjct: 5540 VDPAHLRTQLKKHKEFQTMLGANQAGLDATVKMGKQLMDRSLDEDA-ITIEGKIADLKAR 5598

Query: 278  WERLVQSSS*RETSCRKRL 222
            W+ +   S  R+    + L
Sbjct: 5599 WDAVCGLSVERQQKLEEAL 5617



 Score = 34.7 bits (76), Expect = 0.058
 Identities = 21/97 (21%), Positives = 47/97 (48%), Gaps = 3/97 (3%)
 Frame = -3

Query: 288  GRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSED-YGKDLTSVQN 112
            GR   A   + + K N   +    +Q+N  +E+++ W+ EV+ ++  +     +  +V+ 
Sbjct: 2214 GRYNDALAQLMDRKYNLENDVTNARQFNATLEELDNWIPEVKERVAKQQPISTEPETVRK 2273

Query: 111  LQKKHALLEADVSSHAERIDAIREPGR--ASS*KREP 7
              ++  LL+ D++ H   ++     G+   SS K +P
Sbjct: 2274 QLEEAQLLKDDIAKHNAILEMAENAGQQLISSSKHDP 2310



 Score = 29.9 bits (64), Expect = 1.7
 Identities = 17/72 (23%), Positives = 33/72 (45%), Gaps = 2/72 (2%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ--ISSRVEELGGIW 276
            D   L  +  +H+  +QE+  N+P    +   G+ L E    A+ Q  +  +V ++   W
Sbjct: 3660 DLDTLKYQKTEHEPMQQEILNNEPSYAALMKAGESLKEASQSAEEQDNLDEKVADISRRW 3719

Query: 275  ERLVQSSS*RET 240
            + L   S+ R +
Sbjct: 3720 DELKSKSNERSS 3731



 Score = 29.1 bits (62), Expect = 2.9
 Identities = 16/76 (21%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSED-YGKDLTSVQNLQKKHALLEAD 79
            ELK    +E A   +++ A+  +E WL +V+  + ++     D  +V+   ++   +  D
Sbjct: 2665 ELKDKVDEEVAMSDKFHDALSALEEWLPKVQEAVSNQQPISGDPETVKKQLQEAENIRDD 2724

Query: 78   VSSHAERIDAIREPGR 31
            ++ +   +D + + GR
Sbjct: 2725 INKYRGLLDKLEDTGR 2740



 Score = 28.3 bits (60), Expect = 5.1
 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 1/63 (1%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREP 37
            +YN AV+ +  WL E E QL + E    D  ++ N  +    +  D+       D   E 
Sbjct: 3303 KYNEAVKTLVPWLEETEAQLAAMEPITPDTMALDNRAEVLEDIRKDIDRQKATRDTTEEK 3362

Query: 36   GRA 28
             +A
Sbjct: 3363 SKA 3365


>SB_53744| Best HMM Match : Spectrin (HMM E-Value=1.8e-28)
          Length = 140

 Score = 37.1 bits (82), Expect = 0.011
 Identities = 16/61 (26%), Positives = 28/61 (45%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           ++D+   D  +    + +HQ +  E+ A           G+ LLE EH+A   I  ++E 
Sbjct: 55  SSDELAKDVASAEALIDRHQEYRAEIDARDSTFQAFDDFGRELLEKEHYASSDIQEKLEN 114

Query: 290 L 288
           L
Sbjct: 115 L 115



 Score = 32.7 bits (71), Expect = 0.24
 Identities = 15/70 (21%), Positives = 33/70 (47%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL ++   Q++     D+  W+  ++  + S++  KD+ S + L  +H    A++ +   
Sbjct: 26  KLLDSYDYQRFLNEFRDLISWIHGIKALVSSDELAKDVASAEALIDRHQEYRAEIDARDS 85

Query: 60  RIDAIREPGR 31
              A  + GR
Sbjct: 86  TFQAFDDFGR 95


>SB_7010| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 579

 Score = 35.1 bits (77), Expect = 0.044
 Identities = 23/73 (31%), Positives = 35/73 (47%)
 Frame = -3

Query: 300 RGRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTS 121
           +GR  R  G    + + K  KL    Q     + + DI   ++E +  LLSEDYGKD   
Sbjct: 442 KGRILRLWGGLQDMIKRKKEKLMRCMQLSILLQGMTDIIDSINETKVVLLSEDYGKDHVE 501

Query: 120 VQNLQKKHALLEA 82
            QN+ +    ++A
Sbjct: 502 GQNIVEGEITVKA 514


>SB_32817| Best HMM Match : Spectrin (HMM E-Value=3.7e-21)
          Length = 217

 Score = 34.7 bits (76), Expect = 0.058
 Identities = 17/56 (30%), Positives = 31/56 (55%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           KL EA +   +NR   D+   ++E      S + G+DL +V+ L +KH  +E +++
Sbjct: 60  KLAEACEIHAFNRNCRDVSSMINEKAAVQTSGEVGRDLPAVEALIRKHDDVERELT 115


>SB_48318| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1243

 Score = 32.7 bits (71), Expect = 0.24
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T + NQAEP+
Sbjct: 515 RVNRRSRRPQRQPQQRSPQAPTVHANQAEPI 545


>SB_27367| Best HMM Match : rve (HMM E-Value=9.5e-17)
          Length = 1590

 Score = 32.7 bits (71), Expect = 0.24
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T + NQAEP+
Sbjct: 297 RVNRRSRRPQRQPQQRSPQAPTVHANQAEPI 327


>SB_27735| Best HMM Match : Retrotrans_gag (HMM E-Value=0.097)
          Length = 812

 Score = 32.7 bits (71), Expect = 0.24
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T + NQAEP+
Sbjct: 297 RVNRRSRRPQRQPQQRSPQAPTVHANQAEPI 327


>SB_19685| Best HMM Match : Retrotrans_gag (HMM E-Value=0.061)
          Length = 335

 Score = 32.7 bits (71), Expect = 0.24
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T + NQAEP+
Sbjct: 297 RVNRRSRRPQRQPQQRSPQAPTVHANQAEPI 327


>SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1174

 Score = 31.5 bits (68), Expect = 0.54
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = +2

Query: 257 KTAPVAPIFRPALPRETIFEVEQNVRAQADACRRPLSRRREACWPAA 397
           +T+   P+ R    R+ +   + NVR  A  CRRP S+     WP A
Sbjct: 395 ETSGPPPLKRRTGRRQKLVCAQSNVREAASLCRRPGSKSPYLYWPVA 441


>SB_32265| Best HMM Match : Bim_N (HMM E-Value=1.5)
          Length = 235

 Score = 31.5 bits (68), Expect = 0.54
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T + NQAEP+
Sbjct: 54  RVNRRSRRPQRQPQQRSPQAPTVHVNQAEPI 84


>SB_9739| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1552

 Score = 31.5 bits (68), Expect = 0.54
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RR+ R  R    R+P A T + NQAEP+
Sbjct: 275 RVNRRARRPQRQPQQRSPQAPTVHANQAEPI 305


>SB_42397| Best HMM Match : rve (HMM E-Value=0.0007)
          Length = 729

 Score = 31.1 bits (67), Expect = 0.72
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T +  QAEP+
Sbjct: 297 RVNRRSRRSHRQPQQRSPQAPTVHATQAEPI 327


>SB_11337| Best HMM Match : Bim_N (HMM E-Value=0.45)
          Length = 286

 Score = 31.1 bits (67), Expect = 0.72
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T +  QAEP+
Sbjct: 28  RVNRRSRRSQRQPQQRSPQAPTVHATQAEPI 58


>SB_56471| Best HMM Match : RVT_1 (HMM E-Value=0.00041)
          Length = 1155

 Score = 31.1 bits (67), Expect = 0.72
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T +  QAEP+
Sbjct: 28  RVNRRSRRSQRQPQQRSPQAPTVHATQAEPI 58


>SB_37908| Best HMM Match : Retrotrans_gag (HMM E-Value=0.067)
          Length = 449

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T +  QAEP+
Sbjct: 297 RVNRRSRRPQRQPQQRSPQAPTVHATQAEPI 327


>SB_14964| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1149

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T +  QAEP+
Sbjct: 267 RVNRRSRRPQRQPQQRSPQAPTVHATQAEPI 297


>SB_1237| Best HMM Match : rve (HMM E-Value=0.00029)
          Length = 1026

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T +  QAEP+
Sbjct: 54  RVNRRSRRPQRQPQQRSPQAPTVHATQAEPI 84


>SB_31861| Best HMM Match : rve (HMM E-Value=3.6e-07)
          Length = 1253

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T +  QAEP+
Sbjct: 297 RVNRRSRRPQRQPQQRSPQAPTVHATQAEPI 327


>SB_29927| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 820

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T +  QAEP+
Sbjct: 122 RVNRRSRRPQRQPQQRSPQAPTVHATQAEPI 152


>SB_27036| Best HMM Match : RVT_1 (HMM E-Value=0.00041)
          Length = 1059

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T +  QAEP+
Sbjct: 229 RVNRRSRRPQRQPQQRSPQAPTVHATQAEPI 259


>SB_10546| Best HMM Match : Bim_N (HMM E-Value=0.83)
          Length = 335

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T +  QAEP+
Sbjct: 154 RVNRRSRRPQRQPQQRSPQAPTVHATQAEPI 184


>SB_59115| Best HMM Match : Spectrin (HMM E-Value=0)
          Length = 1457

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 15/62 (24%), Positives = 31/62 (50%), Gaps = 1/62 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSE-DYGKDLTSVQNLQKKHALLEADVSSHAERIDAIRE 40
           + YN  ++++  WL E E +L ++ D   D+  V++    H     +++SH   +  + E
Sbjct: 479 EDYNAQLQEVLTWLREAETKLSNQADISTDVDVVKDQFHDHEDFMMELTSHQASVGGVLE 538

Query: 39  PG 34
            G
Sbjct: 539 FG 540


>SB_54885| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2988

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 17/49 (34%), Positives = 21/49 (42%)
 Frame = -2

Query: 424 CRNIRTSNRSCRPTSLASTR*RPSASVCLSSNILLNLKYRLAWKSWAEY 278
           CR+  T ++ C P S  ST+  P  SVCL S            K W  Y
Sbjct: 97  CRSNCTRSKQCFPLSRDSTKGSPYDSVCLYSTHCHRNTSMACSKGWQTY 145


>SB_22904| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.03)
          Length = 294

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 10/33 (30%), Positives = 20/33 (60%)
 Frame = -3

Query: 195 EDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           E++  W+ E +  L  E+ GKD+ +V+   ++H
Sbjct: 53  EEMRSWIQEKDAALCKEELGKDIETVRAQLRRH 85


>SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3306

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 14/55 (25%), Positives = 29/55 (52%)
 Frame = -3

Query: 222 QQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           ++Q + +A+ED E WL + E + L E+        ++LQ +      + +S A++
Sbjct: 678 KRQNFQQALEDFETWLVQTEEKELMEEIELHEPIHKDLQTRGVTAAKEATSRADQ 732


>SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05)
          Length = 3397

 Score = 29.1 bits (62), Expect = 2.9
 Identities = 12/38 (31%), Positives = 24/38 (63%)
 Frame = -3

Query: 261  VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLS 148
            V +++   +  AA+ QQ++  +ED+  WL ++E +L S
Sbjct: 3047 VVQMRSQIVSHAARYQQFDFVLEDLLQWLLDMEKRLTS 3084


>SB_45859| Best HMM Match : RVT_1 (HMM E-Value=0.0014)
          Length = 471

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -1

Query: 113 ISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           ++RRS R  R    R+P A T +  QAEP+
Sbjct: 2   VNRRSRRPQRQPQQRSPQAPTVHATQAEPI 31


>SB_45545| Best HMM Match : Vicilin_N (HMM E-Value=1.1)
          Length = 729

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 5/48 (10%)
 Frame = -3

Query: 162 GQLLSEDYGKDL--TSVQNLQKKHALLEADVSSHAE---RIDAIREPG 34
           G L+  D+  DL   ++Q+LQ++H  + A  +SH E   R+ +  +PG
Sbjct: 348 GDLMRPDHRLDLRAAALQDLQRRHEAMRAGEASHRELLGRMASSHKPG 395


>SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 6489

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 10/28 (35%), Positives = 19/28 (67%)
 Frame = -2

Query: 388  PTSLASTR*RPSASVCLSSNILLNLKYR 305
            PT + +T  +P+   C SS++L NL+++
Sbjct: 2811 PTQMVNTPLKPNTKNCYSSHVLKNLRFK 2838


>SB_35552| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1044

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 4/59 (6%)
 Frame = -3

Query: 294  RAGRNMGATGAVFELKGNKLQEAAQQQQ----YNRAVEDIELWLSEVEGQLLSEDYGKD 130
            RAGR  G      E +   L++   Q+Q    Y+   ED E  L   +G  + EDYG+D
Sbjct: 964  RAGREGGGDDYEQEYEEEYLEDGTIQEQDEPYYDDYYEDQET-LGYEDGNFVDEDYGRD 1021


>SB_910| Best HMM Match : Cation_efflux (HMM E-Value=0.056)
          Length = 416

 Score = 28.3 bits (60), Expect = 5.1
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%)
 Frame = +2

Query: 461 RRWRTFSFLVYPTFSFITIAFRTVDTL*GGLSKESA--GAWFDFF 589
           R+WR F+  +  TF+ +++ F T++   GG  + S+     FD F
Sbjct: 64  RKWRKFAVCLVITFAVVSLLFATLEFALGGDRQSSSVISTGFDTF 108


>SB_55826| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1199

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 2/36 (5%)
 Frame = -3

Query: 162  GQLLSEDYGKDL--TSVQNLQKKHALLEADVSSHAE 61
            G L+  D+  DL   ++Q+LQ++H  + A  +SH E
Sbjct: 1152 GDLMRPDHRLDLRAAALQDLQRRHEAMRAGEASHRE 1187


>SB_54429| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 383

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = -3

Query: 432 WQGAETSELRTGAAGQQASRR 370
           WQG +T++    A GQQ S+R
Sbjct: 276 WQGLQTNQTNLSATGQQQSQR 296


>SB_50061| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1222

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R P A T +  Q EP+
Sbjct: 297 RVNRRSRRPQRQPQQRLPQAPTVHATQEEPI 327


>SB_44676| Best HMM Match : Bim_N (HMM E-Value=0.83)
          Length = 253

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = -1

Query: 116 RISRRSTRCWRPT*ARTPNASTPYGNQAEPV 24
           R++RRS R  R    R+P A T +  QA P+
Sbjct: 174 RVNRRSRRPQRQPQQRSPQAPTVHATQAGPI 204


>SB_41836| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.5e-07)
          Length = 1128

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 14/57 (24%), Positives = 29/57 (50%)
 Frame = -1

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS 252
           Q+ + FE+ L   K +  ++ +  + L  L    Q +++S+ EE+G +   L +  S
Sbjct: 178 QEKEMFEEMLLQEKQKSKDLASSEENLQNLNKTLQDELNSKNEEIGKLRPMLTERDS 234


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,982,843
Number of Sequences: 59808
Number of extensions: 365208
Number of successful extensions: 1373
Number of sequences better than 10.0: 48
Number of HSP's better than 10.0 without gapping: 1181
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1367
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1463691625
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).