SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0035
         (392 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)             103   4e-23
SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)             103   4e-23
SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)              103   4e-23
SB_56| Best HMM Match : Actin (HMM E-Value=0)                         103   4e-23
SB_56628| Best HMM Match : Actin (HMM E-Value=0)                      103   4e-23
SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)              103   4e-23
SB_54| Best HMM Match : Actin (HMM E-Value=0)                          48   3e-06
SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)                  46   8e-06
SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   1e-05
SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)                 44   4e-05
SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)               34   0.047
SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.11 
SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.19 
SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)                    32   0.19 
SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.44 
SB_18636| Best HMM Match : GPS (HMM E-Value=8.4)                       30   0.58 
SB_146| Best HMM Match : DUF836 (HMM E-Value=1.5)                      29   1.0  
SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.3  
SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.8  
SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.8  
SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55)                    28   3.1  
SB_50421| Best HMM Match : CUB (HMM E-Value=0)                         27   5.4  
SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_51284| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_9222| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-06)                  27   7.2  
SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)                  27   7.2  
SB_51157| Best HMM Match : Pkinase (HMM E-Value=0.00029)               26   9.5  
SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.)              26   9.5  
SB_2329| Best HMM Match : No HMM Matches (HMM E-Value=.)               26   9.5  
SB_56014| Best HMM Match : 7tm_1 (HMM E-Value=1.6e-08)                 26   9.5  
SB_44353| Best HMM Match : GRP (HMM E-Value=4.9)                       26   9.5  
SB_37572| Best HMM Match : No HMM Matches (HMM E-Value=.)              26   9.5  
SB_19172| Best HMM Match : GRP (HMM E-Value=4.9)                       26   9.5  
SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9)                   26   9.5  

>SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 338

 Score =  103 bits (248), Expect = 4e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 1e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D++VAALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 376

 Score =  103 bits (248), Expect = 4e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 74.1 bits (174), Expect = 4e-14
 Identities = 34/39 (87%), Positives = 36/39 (92%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           M D+E+AALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MEDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 375

 Score =  103 bits (248), Expect = 4e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 71.3 bits (167), Expect = 3e-13
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +++VAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>SB_56| Best HMM Match : Actin (HMM E-Value=0)
          Length = 375

 Score =  103 bits (248), Expect = 4e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 82



 Score = 72.5 bits (170), Expect = 1e-13
 Identities = 33/37 (89%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           ++EVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>SB_56628| Best HMM Match : Actin (HMM E-Value=0)
          Length = 376

 Score =  103 bits (248), Expect = 4e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 78.6 bits (185), Expect = 2e-15
 Identities = 35/39 (89%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD++VAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 349

 Score =  103 bits (248), Expect = 4e-23
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 74.1 bits (174), Expect = 4e-14
 Identities = 32/39 (82%), Positives = 36/39 (92%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           M D+++AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>SB_54| Best HMM Match : Actin (HMM E-Value=0)
          Length = 2486

 Score = 48.0 bits (109), Expect = 3e-06
 Identities = 19/31 (61%), Positives = 25/31 (80%)
 Frame = +2

Query: 167  LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
            +V+DNGSG CKAG +  ++PR VFP+IVG P
Sbjct: 2097 VVIDNGSGFCKAGLSTDESPRVVFPAIVGRP 2127


>SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12)
          Length = 1392

 Score = 46.4 bits (105), Expect = 8e-06
 Identities = 22/36 (61%), Positives = 24/36 (66%)
 Frame = +2

Query: 152  EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
            E    LV+D GS M K GFAG DAP+ VFP IVG P
Sbjct: 1354 EAPTPLVIDVGSHMWKVGFAGDDAPKGVFPPIVGRP 1389


>SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 411

 Score = 45.6 bits (103), Expect = 1e-05
 Identities = 20/43 (46%), Positives = 28/43 (65%)
 Frame = +2

Query: 161 AALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA*WSVWD 289
           + +V DNG+G  K G+AG + P  +FPS+VG P IR+   V D
Sbjct: 7   SVIVCDNGTGFVKCGYAGSNFPAHIFPSMVGRPIIRSSQKVGD 49



 Score = 44.0 bits (99), Expect = 4e-05
 Identities = 18/33 (54%), Positives = 23/33 (69%)
 Frame = +1

Query: 292 KDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           KD  VGDEA   R +L + YP+++GI  NWDDM
Sbjct: 53  KDLMVGDEASQLRYMLEVNYPMDNGIVRNWDDM 85


>SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022)
          Length = 921

 Score = 44.0 bits (99), Expect = 4e-05
 Identities = 19/41 (46%), Positives = 27/41 (65%)
 Frame = +2

Query: 137 FKMCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           FK+      A+V+DNG G+ K GFAG   PR + P++VG+P
Sbjct: 693 FKLDSHYNRAIVLDNGCGISKIGFAGDRVPRIIQPAVVGNP 733


>SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6)
          Length = 372

 Score = 33.9 bits (74), Expect = 0.047
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = +1

Query: 280 GMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+   D ++GDEA  K    T K+PI H I  +WD M
Sbjct: 278 GVEDLDFFIGDEAIDKPSYAT-KWPIRHAIVEDWDLM 313


>SB_13343| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 198

 Score = 32.7 bits (71), Expect = 0.11
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = -2

Query: 256 ASHDRGKHCARSIISCEAGLAHTGAIVYYQRGNFFV 149
           ++ D G++ + SI+S E GLAHTGAI+  Q  +  V
Sbjct: 4   SADDGGENGSGSIVSGETGLAHTGAIIDNQSCDIIV 39


>SB_37540| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 31.9 bits (69), Expect = 0.19
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -3

Query: 240 GNTARGASYPAKPALHIPEPLSTT 169
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8)
          Length = 170

 Score = 31.9 bits (69), Expect = 0.19
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = -3

Query: 240 GNTARGASYPAKPALHIPEPLSTT 169
           GNT R    PAKPAL++P P S T
Sbjct: 80  GNTNRRTRIPAKPALNLPSPPSKT 103


>SB_35780| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 749

 Score = 30.7 bits (66), Expect = 0.44
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = -3

Query: 240 GNTARGASYPAKPALHIPEPLSTT 169
           GNT R    PAKP+L++P P S T
Sbjct: 540 GNTNRRTRIPAKPSLNLPSPPSKT 563


>SB_18636| Best HMM Match : GPS (HMM E-Value=8.4)
          Length = 513

 Score = 30.3 bits (65), Expect = 0.58
 Identities = 14/43 (32%), Positives = 22/43 (51%)
 Frame = -2

Query: 145 HLELVKLVRCRCDKMKIKRPAVTANREKQIPDCRPGAGTPAPG 17
           HL+ +   +C   K+KIK+     N + ++P C P    P PG
Sbjct: 185 HLQRISAEQC---KLKIKQHFTPENVKVRLPKCEPSIWDPIPG 224


>SB_146| Best HMM Match : DUF836 (HMM E-Value=1.5)
          Length = 554

 Score = 29.5 bits (63), Expect = 1.0
 Identities = 15/37 (40%), Positives = 18/37 (48%)
 Frame = +3

Query: 198 RPASQDMMLLAQCFPRSWEAPPSGRDGRYGTEGLLCR 308
           +P  +DM     C PR W  P   R+GR  T  L CR
Sbjct: 263 KPKCRDMNCDV-CAPRQWLEPTEKREGREVTNKLRCR 298


>SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2162

 Score = 29.1 bits (62), Expect = 1.3
 Identities = 13/45 (28%), Positives = 16/45 (35%)
 Frame = -2

Query: 241 GKHCARSIISCEAGLAHTGAIVYYQRGNFFVAHLELVKLVRCRCD 107
           G+HC + I  C  G    GA      GN+     E      C  D
Sbjct: 724 GRHCEKDIDECSLGYCKNGATCTNTPGNYSCQCTEFTNGTNCELD 768


>SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 28.7 bits (61), Expect = 1.8
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = -3

Query: 240 GNTARGASYPAKPALHIPEPLSTT 169
           GNT R     AKPAL++P P S T
Sbjct: 40  GNTNRRTRIQAKPALNLPSPPSKT 63


>SB_11603| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 635

 Score = 28.7 bits (61), Expect = 1.8
 Identities = 13/24 (54%), Positives = 14/24 (58%)
 Frame = -3

Query: 240 GNTARGASYPAKPALHIPEPLSTT 169
           GNT R    PAKP L IP P + T
Sbjct: 68  GNTNRRTRIPAKPTLTIPSPPTKT 91


>SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55)
          Length = 1346

 Score = 27.9 bits (59), Expect = 3.1
 Identities = 21/61 (34%), Positives = 28/61 (45%)
 Frame = -3

Query: 351 VFEGQDTSFALCLISYIRVLLSHTDHHALMAGLPTIEGNTARGASYPAKPALHIPEPLST 172
           V EG D  FA C++SY+  LL +  H   + GLP   G       +  K A H   P  T
Sbjct: 238 VREGGDV-FANCVVSYVARLLRNRGHSRSL-GLPKTRGKIFE--RFDKKLATHGVHPKKT 293

Query: 171 T 169
           +
Sbjct: 294 S 294


>SB_50421| Best HMM Match : CUB (HMM E-Value=0)
          Length = 270

 Score = 27.1 bits (57), Expect = 5.4
 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 3/50 (6%)
 Frame = +3

Query: 3   PAGRIPGAGVPAPGRQSGICFSRLAVTAGRLI---FILSHLHLTNFTNSR 143
           P+G     G P+P      C  R++VT G  I   F + HL  T+F   +
Sbjct: 49  PSGAFTSPGYPSPYPLGRHCEWRISVTPGERIVLNFTVFHLKKTSFNKCK 98


>SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 6863

 Score = 26.6 bits (56), Expect = 7.2
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 195  ARPASQDMMLLAQCFPRSWEAPPSGRDGRYGTEGL 299
            AR   QD +  A C  R+++   SGR+   GT+G+
Sbjct: 6603 ARSTPQDSV--AACDARNYDGKESGRESTEGTDGI 6635


>SB_51284| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 603

 Score = 26.6 bits (56), Expect = 7.2
 Identities = 12/34 (35%), Positives = 15/34 (44%)
 Frame = -3

Query: 381 PVSGDSVFDGVFEGQDTSFALCLISYIRVLLSHT 280
           P  GDS  D VF  +   F  C+   I +   HT
Sbjct: 174 PTRGDSYLDNVFTNRPDLFGECIPYNISIKTDHT 207


>SB_9222| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-06)
          Length = 425

 Score = 26.6 bits (56), Expect = 7.2
 Identities = 12/30 (40%), Positives = 18/30 (60%)
 Frame = -2

Query: 205 AGLAHTGAIVYYQRGNFFVAHLELVKLVRC 116
           +G  +T A VY+QRGN +  H + V  + C
Sbjct: 358 SGRGNTWA-VYFQRGNTWTVHFQRVNTMGC 386


>SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011)
          Length = 580

 Score = 26.6 bits (56), Expect = 7.2
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAV 235
           ++A LV+D G+   K GFA   APR++
Sbjct: 232 KMATLVLDCGACSQKIGFASNQAPRSI 258


>SB_51157| Best HMM Match : Pkinase (HMM E-Value=0.00029)
          Length = 161

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +2

Query: 137 FKMCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFP 241
           FK+CD  ++  +VD+ +    AG   Y AP  + P
Sbjct: 15  FKLCDFGISGQLVDSLAKTVDAGCKPYMAPERINP 49


>SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 285

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = -3

Query: 255 LPTIEGNTARGASYPAKPALHIPEPLSTTNAATSSSH 145
           L  IE +    A+ P  P + +P+ +   +AAT +SH
Sbjct: 222 LRRIERSNIPQATAPGTPGVPVPQAVHGVSAATQASH 258


>SB_2329| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1181

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 18/72 (25%), Positives = 33/72 (45%)
 Frame = -2

Query: 304 HKSPSVPYRPSRPDGGASHDRGKHCARSIISCEAGLAHTGAIVYYQRGNFFVAHLELVKL 125
           ++S  +P R S+   G  HD  ++    I+   AGL       YY+  +   +  +L+K 
Sbjct: 326 NQSVVIPRRSSKKMEGL-HDMNQYLNTEIVCTLAGLGCAEGTEYYKSPDCLESLKDLIKF 384

Query: 124 VRCRCDKMKIKR 89
           +R      +I+R
Sbjct: 385 LRRDDSTCEIRR 396


>SB_56014| Best HMM Match : 7tm_1 (HMM E-Value=1.6e-08)
          Length = 300

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 2/54 (3%)
 Frame = +3

Query: 72  LAVTAGRLIFILSHLHLTNF-TNSRCATKKLPRW**TMAPVC-ARPASQDMMLL 227
           LAV+A R+I +  HL  T+  TN+R     +  W  T+   C +  AS  +ML+
Sbjct: 117 LAVSADRVIALYLHLRYTSIVTNNRVVKLHIIIWTVTVPFTCLSLLASHSVMLI 170


>SB_44353| Best HMM Match : GRP (HMM E-Value=4.9)
          Length = 361

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 13/28 (46%), Positives = 13/28 (46%)
 Frame = -2

Query: 115 RCDKMKIKRPAVTANREKQIPDCRPGAG 32
           R  K K KRP  T    KQ P C  G G
Sbjct: 128 RVRKRKRKRPTATTTTTKQGPVCGRGGG 155


>SB_37572| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 314

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = +2

Query: 137 FKMCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFP 241
           FK+CD  ++  +VD+ +    AG   Y AP  + P
Sbjct: 168 FKLCDFGISGQLVDSLAKTVDAGCKPYMAPERINP 202


>SB_19172| Best HMM Match : GRP (HMM E-Value=4.9)
          Length = 278

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 13/28 (46%), Positives = 13/28 (46%)
 Frame = -2

Query: 115 RCDKMKIKRPAVTANREKQIPDCRPGAG 32
           R  K K KRP  T    KQ P C  G G
Sbjct: 45  RVRKRKRKRPTATTTTTKQGPVCGRGGG 72


>SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9)
          Length = 224

 Score = 26.2 bits (55), Expect = 9.5
 Identities = 13/28 (46%), Positives = 13/28 (46%)
 Frame = -2

Query: 115 RCDKMKIKRPAVTANREKQIPDCRPGAG 32
           R  K K KRP  T    KQ P C  G G
Sbjct: 128 RVRKRKRKRPTATTTTTKQGPVCGRGGG 155


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,009,616
Number of Sequences: 59808
Number of extensions: 324658
Number of successful extensions: 811
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 726
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 809
length of database: 16,821,457
effective HSP length: 75
effective length of database: 12,335,857
effective search space used: 678472135
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).