SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0034
         (628 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_5835| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   1.0  
SB_2775| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   3.1  
SB_7671| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   4.1  
SB_44922| Best HMM Match : RNA_pol_Rpb1_1 (HMM E-Value=0)              28   5.4  
SB_5823| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   5.4  
SB_23637| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.1  
SB_16024| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.1  
SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4)                      28   7.1  
SB_18577| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.1  
SB_57352| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.4  
SB_29033| Best HMM Match : Ion_trans_2 (HMM E-Value=8.1e-29)           27   9.4  
SB_25009| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.4  

>SB_5835| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 875

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 11/26 (42%), Positives = 20/26 (76%)
 Frame = +3

Query: 306 NTTSLDHAAGL*KIPPWSCKSRIRRR 383
           +T SL+ AAG  ++PP +C +R+R++
Sbjct: 15  DTVSLESAAGSKRLPPRACSNRVRKK 40


>SB_2775| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 14/51 (27%), Positives = 26/51 (50%)
 Frame = -1

Query: 229 LTHGNTAFATFF*TEPSQLHEFTQSYQNEFRETDHFNISNDWNTNDNFCHH 77
           L H N   A++   +PSQ ++ +     E    D +N S+ ++ N++  HH
Sbjct: 4   LRHPNHRHASYSGRKPSQRNDDSSQVWCELLAKDKYNASDTFDPNNHTSHH 54


>SB_7671| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 114

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 13/46 (28%), Positives = 21/46 (45%)
 Frame = +1

Query: 235 TELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEKFRHGHANPG 372
           TEL++ S E + RRR    ++P     VW  +++          PG
Sbjct: 18  TELIRRSGEKMTRRRASQHSSPQSQTVVWMKKKEKRPLAWDRTRPG 63


>SB_44922| Best HMM Match : RNA_pol_Rpb1_1 (HMM E-Value=0)
          Length = 1596

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 2/53 (3%)
 Frame = +1

Query: 319  WTMRQDYEKFRHGHANPGS--GVAEADLVKPPLTVLVIKKVHDAQILAPFVQL 471
            W + +   +F H H  PG   G   A  +  P T + +   H A + A  V L
Sbjct: 1392 WLLGEIETRFNHSHGKPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTL 1444


>SB_5823| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2324

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 10/30 (33%), Positives = 16/30 (53%)
 Frame = -2

Query: 213  LPSQHFFKQSHHSYTNSHRATKTSFAKPII 124
            +PS H+F   +  Y  +H +T    A P+I
Sbjct: 1030 VPSHHYFTNRYSPYQRTHTSTTADGATPVI 1059


>SB_23637| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 114

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 13/46 (28%), Positives = 20/46 (43%)
 Frame = +1

Query: 235 TELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEKFRHGHANPG 372
           TEL++ S E   RRR    ++P     VW  +++          PG
Sbjct: 18  TELIRRSGEKFTRRRASQHSSPQSQTVVWMKKKEKRPLAWDRTRPG 63


>SB_16024| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 13/46 (28%), Positives = 20/46 (43%)
 Frame = +1

Query: 235 TELVKSSEEYLDRRRTRSLNAPSPIQQVWTMRQDYEKFRHGHANPG 372
           TEL++ S E   RRR    ++P     VW  +++          PG
Sbjct: 47  TELIRRSGEKFTRRRASQHSSPQSQTVVWMKKKEKRPLAWDRTRPG 92


>SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4)
          Length = 330

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 4/42 (9%)
 Frame = -2

Query: 210 PSQHFFKQSHHSY---TNSH-RATKTSFAKPIILTYQTIGTR 97
           PS H   +SHH +   ++SH +++ +S  KP+I    T+G R
Sbjct: 215 PSSHSTNRSHHHHHHHSSSHYKSSSSSSLKPLIPPSPTLGLR 256


>SB_18577| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 367

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 13/30 (43%), Positives = 20/30 (66%)
 Frame = +2

Query: 302 PQYNKFGPCGRIMKNSAMVMQIQDPASQRL 391
           PQ + FGPCG   K +A+VM++  P+ + L
Sbjct: 103 PQVHYFGPCG---KYNALVMELLGPSLEDL 129


>SB_57352| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 213

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = -1

Query: 583 FFHPTVKSPILPQRSVSSKNCRLDEPPPCF 494
           F H ++     P+R +S  NC    P PCF
Sbjct: 39  FEHNSISMGKTPKRKLSLSNCDNASPSPCF 68


>SB_29033| Best HMM Match : Ion_trans_2 (HMM E-Value=8.1e-29)
          Length = 387

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 15/54 (27%), Positives = 30/54 (55%)
 Frame = +1

Query: 406 PLTVLVIKKVHDAQILAPFVQLVHWLVHDKSMVVVRRGGSFWMTHSFAGVLGTL 567
           PL ++++K + D   +   +  VH+L+  +   V++R G +  T++    LGTL
Sbjct: 131 PLNLMILKNLGDR--IKDVIHYVHFLLATR---VMKREGEYLTTYTLPWTLGTL 179


>SB_25009| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 641

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 11/40 (27%), Positives = 20/40 (50%)
 Frame = +2

Query: 323 PCGRIMKNSAMVMQIQDPASQRLTWSSLPSPCWSSRKFTT 442
           P G +MK +  V + +   +  + WS++ SP   +  F T
Sbjct: 527 PSGSVMKTTVTVWETKFVTASNIAWSTISSPLPMTTVFVT 566


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,382,751
Number of Sequences: 59808
Number of extensions: 474608
Number of successful extensions: 1355
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1251
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1355
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1560464625
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).